KEGG   Mus musculus (mouse): 60344
Entry
60344             CDS       T01002                                 

Gene name
Fign, Fgn, fi, fidget
Definition
(RefSeq) fidgetin
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: AAA Vps4_C AAA_lid_3 AAA_5 AAA_16 AAA_22 TIP49 RuvB_N
Other DBs
NCBI-GeneID: 60344
NCBI-ProteinID: NP_068362
MGI: 1890647
Ensembl: ENSMUSG00000075324
Vega: OTTMUSG00000012785
UniProt: Q9ERZ6
Position
2 C1.3; 2 37.19 cM
AA seq 759 aa
MISSTSVYGLKMQWTPEHAQWPEQHFDITSTTRSPAHKVEAYRGHLQRTYQYAWANDDIS
ALTASNLLKKYAEKYSGILEGPVDRPVLSNYSDTPSGLVNGRKNDSEPWQPSLNSEAVYP
MNCVPDVITASKAGVSSALPPVDVSASIGSSPGVASNLTEPSYSSSTCGSHTVPSLHAGL
PSQEYAPGYNGSYLHSTYSSQATPALPSPHPSPLHSSGLLQPPPPPPPPPALVPGYNGTS
NLSSYSYPSASYPPQTAVGSGYSPGGAPPPPSAYLPSGIPAPTPLPPTTVPGYTYQGHGL
TPIAPSALTNNSASSLKRKAFYMAGQGDMDSSYGNYSYGQQRSTQSPMYRMPDNSISNSN
RGNGFDRNAETSSLAFKPTKQLMPSEQQRKFSSQSSRALTPPSYSTAKNSLGSRSSESFG
KYTSPVMSEHGDDHRQLLAHPIQGPGLRAATSSNHSVDEQLKNTDTHLIDLVTNEIITQG
PPVDWSDIAGLDLVKAVIKEEVLWPVLRSDAFSGLTALPRSILLFGPRGTGKTLLGRCIA
SQLGATFFKIAGSGLVAKWIGEAEKIIHASFLVARCRQPSVIFVSDIDMLLSSQVSEEHS
PVSRMRTEFLMQLDTVLTSAEDQIVVICATSKPEEIDESLRRYFMKRLLIPLPDSTARHQ
IIVQLLTQHNYCLNDKEFALLVQRTEGFSGLDVAHLCQEAAVGPLHAMPATDLSAIMPSQ
LRPVTYQDFENAFCKIQPSISQKELDMYVEWNKMFGCSQ
NT seq 2280 nt   +upstreamnt  +downstreamnt
atgatcagtagcaccagtgtttatggcttgaagatgcagtggacgccggagcatgcccag
tggccagaacagcactttgacatcacctcgaccactcggtctcccgcccacaaagttgaa
gcctatagaggtcatttacagcgcacctaccagtatgcctgggcgaatgatgacatatct
gctctgactgcgtccaaccttctgaaaaaatatgcagagaagtattctggcattttggaa
ggtcccgtagaccgacctgtactcagcaattattcagacacaccatcaggactcgtgaat
ggtcggaaaaatgatagcgaaccctggcagccttccttgaattcagaagccgtttatcct
atgaactgtgtcccggatgtcatcactgccagcaaagctggtgtcagctcagccctccct
ccagtagacgtctcggcaagtatagggagctcccctggggtggccagcaacctgacagag
ccaagttactcaagtagtacctgtggaagccacacagtacctagtcttcatgcggggctc
ccatctcaggaatatgctccgggatacaacggctcatatttgcattctacctacagcagc
caggccacacctgcacttccttcgcctcatccgtccccgttgcatagttctgggcttttg
cagccaccaccccctcctcctcccccaccagccctggtcccaggctacaacgggacttcc
aatctctccagttacagttatccctctgctagctatcctcctcagactgccgtggggtct
gggtacagccctggcggagcaccccctcctccttcagcatacctgccttcaggaattcct
gctcccacccctctgccccccactaccgttcctggctacacctaccaaggtcatggtttg
acacccattgcaccctctgctctgaccaacaattcagcaagttctctcaaaaggaaagct
ttctatatggcagggcaaggagacatggactccagttacggaaattacagctatggccaa
cagagatcgacacagagtcctatgtaccgaatgcccgacaacagcatttcaaactcgaat
cgggggaatggctttgacagaaatgctgaaacatcatccttagcatttaagccaacaaag
cagctgatgccctctgagcagcaaaggaaattcagcagccagtccagtagggctctgacc
cctccttcctatagtactgctaaaaattcattgggatcaaggtccagtgaatcctttggg
aagtatacgtcgccagtcatgagtgagcacggagacgaccatcggcagctcctcgctcat
ccaatacaaggtcccggactccgtgcagctacctcatccaaccactctgtggacgagcaa
ctgaagaatactgacacacacctcattgacctggtcaccaatgagatcatcacccaagga
cctcctgtggactggagcgacatagctggtcttgacctggtgaaggcggttattaaggag
gaggttttgtggccagtgctgaggtcagatgcattcagtgggctgaccgccttacctaga
agcatccttctcttcggacctcggggtacaggcaaaacacttttgggcagatgcatagct
agtcagctaggggccacgtttttcaaaattgccggttccggactcgttgcaaagtggata
ggagaagcggagaaaatcatccacgcctcttttcttgtggccaggtgtcgccagccctcg
gtgatttttgttagtgacattgacatgcttctctcctctcaagtgagcgaggaacacagt
ccagtcagtcggatgagaaccgaatttctgatgcagctggacactgtactgacttcggct
gaggaccaaatcgtagtcatttgtgccaccagtaaaccagaagaaatagatgaatctctt
cggaggtacttcatgaaaagacttttaatcccacttcctgacagcacagcgaggcaccag
ataatagtacagctgctcacacagcacaattactgtctcaatgacaaggagtttgcactg
cttgtccagcgcacagaaggcttttctggactagacgtggctcatttgtgtcaggaagca
gcagtgggacctctccatgctatgccagctacagacctttcagccattatgcccagccag
ttaaggcccgttacatatcaagactttgaaaatgctttctgcaagattcagcctagcata
tctcaaaaagagcttgatatgtatgttgaatggaacaaaatgtttggttgcagtcagtga

DBGET integrated database retrieval system