KEGG   Mus musculus (mouse): 60507Help
Entry
60507             CDS       T01002                                 

Gene name
Qtrt1, 2610028E17Rik, Tgt
Definition
(RefSeq) queuine tRNA-ribosyltransferase catalytic subunit 1
  KO
K00773  queuine tRNA-ribosyltransferase [EC:2.4.2.29]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mmu03016]
    60507 (Qtrt1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.29  tRNA-guanosine34 transglycosylase
     60507 (Qtrt1)
Transfer RNA biogenesis [BR:mmu03016]
 Eukaryotic type
  tRNA modification factors
   Other tRNA modification factors
    60507 (Qtrt1)
 Prokaryotic type
    60507 (Qtrt1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGT
Motif
Other DBs
NCBI-GeneID: 60507
NCBI-ProteinID: NP_068688
MGI: 1931441
Ensembl: ENSMUSG00000002825
Vega: OTTMUSG00000063356
UniProt: Q9JMA2
Structure
PDB: 

Position
9; 9 A3
AA seq 403 aa AA seqDB search
MAAVGSPGSLESAPRIMRLVAECSRSGARAGELRLPHGTVATPVFMPVGTQATMKGITTE
QLDSLGCRICLGNTYHLGLRPGPELIRKAQGLHGFMNWPHNLLTDSGGFQMVSLFSLSEV
TEEGVHFRSPYDGEETLLSPERSVEIQNALGSDIIMQLDHVVSSTVTGPLVEEAMHRSVR
WLDRCIAAHKHPDKQNLFAIIQGGLNADLRTTCLKEMTKRDVPGFAIGGLSGGESKAQFW
KMVALSTSMLPKDKPRYLMGVGYATDLVVCVALGCDMFDCVYPTRTARFGSALVPTGNLQ
LKKKQYAKDFSPINPECPCPTCQTHSRAFLHALLHSDNTTALHHLTVHNIAYQLQLLSAV
RSSILEQRFPDFVRNFMRTMYGDHSLCPAWAVEALASVGIMLT
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggtaggcagcccaggttcgcttgagtccgctccacgaataatgcggctggtc
gctgagtgcagtcgctccggagctcgggcgggtgagctgcggctgccgcatggaacggta
gccacccctgtgttcatgcctgtgggtacacaggccaccatgaagggtatcaccacggag
cagctggactccctgggctgccgcatctgcttgggcaacacctaccatctggggctgagg
ccgggaccggagctgatccggaaagcccagggtcttcacggcttcatgaattggccccac
aatctgctgacggatagcggcggcttccagatggtgtccctcttctccctgtccgaggtg
acggaggagggcgtccacttccgctcgccctacgatggagaagagacacttttgagccca
gagaggtcggtggagatccagaatgctctgggctcggacatcatcatgcagttagaccat
gtggtgagcagcacagtgacaggccctctagtggaggaggccatgcacaggtcagtccgc
tggctggacagatgcatcgcagcccataagcacccggacaagcagaacctctttgccatc
atccagggtggactgaatgctgatcttcggaccacttgtctgaaagagatgaccaagaga
gatgtgccgggcttcgccatcggaggtctgagtggaggagaaagcaaggcacagttctgg
aagatggtggcgttgagcacctccatgctgcctaaggacaagccacgatacctgatgggg
gttggctatgccaccgatttggtggtctgcgtggctcttggatgtgacatgttcgactgt
gtgtaccccacacggacagcgcgctttggatccgcccttgtgcccactgggaaccttcag
ttgaagaagaagcagtatgccaaggatttcagccccataaaccctgagtgtccctgtccc
acctgccagacgcacagccgagccttcctgcatgccctgctacacagtgacaacactaca
gcactacaccacctaaccgtgcacaacattgcctatcagctgcagctcctgagtgccgtg
cgcagcagtatcttggaacagcgctttcctgactttgtacgaaacttcatgcgcactatg
tatggtgaccacagcctctgtcctgcctgggccgttgaagcactggcctctgtgggaatc
atgctcacatga

DBGET integrated database retrieval system