KEGG   Mus musculus (house mouse): 60510
Entry
60510             CDS       T01002                                 
Symbol
Syt9
Name
(RefSeq) synaptotagmin IX
  KO
K19909  synaptotagmin-9
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    60510 (Syt9)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Synaptotagmins
    60510 (Syt9)
SSDB
Motif
Pfam: C2 NT-C2
Other DBs
NCBI-GeneID: 60510
NCBI-ProteinID: NP_068689
MGI: 1926373
Ensembl: ENSMUSG00000062542
Vega: OTTMUSG00000031453
UniProt: Q9R0N9
Position
7:106969556..107147863
AA seq 491 aa
MPGARDALCHQALQLLAELCARGALEHDSCQDFIYHLRDRARPRLRDPDISVSLLTLVVT
ACGLALFGVSLFVSWKLCWVPWRERGLFSGSKDNNQEPLNYTDTETNEQENSEDFLDPPT
PCPDSSMKISHTSPDIPLSTQPGGQENCAHAVRVQRQVTEPTPSARHNSIRRQLNLSNPD
FNIQQLQRQEQLTGIGRIKPELYKQRSLDNDDGRRSNSKACGKLNFILKYDCDLEQLIVK
IHKAVNLPAKDFSGTSDPYVKIYLLPDRKTKHQTKVHRKTLNPVFDEVFLFPVHYNDLEA
RKLHFSVYDFDRFSRHDLIGQVVVDHFFDLADFPRECILWKDIEYVTNDNVDLGELMFSL
CYLPTAGRLTITIIKARNLKAMDITGASDPYVKVSLMCDGRRLKKRKTSTKRNTLNPVYN
EAIVFDVPPESIDQIHLSIAVMDYDRVGHNEVIGVCQVGNEAERLGRDHWSEMLSYPRKP
IAHWHSLMEKR
NT seq 1476 nt   +upstreamnt  +downstreamnt
atgcccggggccagggacgcgctctgtcaccaggcgctgcagctgctggccgagctctgt
gcccgaggggccctggagcacgacagctgccaagatttcatctaccacctgcgggaccgt
gccagaccccggctccgcgacccagatatctctgtgagcctgctaaccctcgtggttact
gcctgtggtctggccctttttggtgtctctcttttcgtgtcttggaaactgtgctgggtt
ccgtggcgagagcgaggcctgttctctggtagcaaagacaacaaccaagagcctcttaat
tacaccgacacagagacaaacgagcaggagaacagcgaggacttcctagacccacctaca
ccctgccctgactcctccatgaagataagccacacttcccccgacattcccctctccacc
cagccagggggccaggagaactgtgcccatgccgtccgtgtgcagcgacaagtcacagag
ccaacaccatcagctcggcataactcaatccgaagacagctcaacctgtcgaacccggac
tttaatatccagcagcttcagaggcaggagcagctgactgggattggtagaattaaacca
gagttatacaaacagaggtcactggacaacgacgatgggcggaggagtaacagcaaagcc
tgcgggaaactgaacttcattttaaaatatgactgcgacttggaacagctcattgtgaag
atccacaaagccgtcaatctgcctgccaaggacttctctgggacttcagatccttatgtc
aagatctacttgcttcctgaccggaaaacaaaacaccagactaaagttcacaggaagacc
ctgaaccctgtgtttgatgaggtgtttttatttcctgttcactacaatgaccttgaagct
cggaagcttcacttctctgtgtatgactttgacaggttctctcgccatgacctgattggt
caggtggtggtggaccacttcttcgacttggccgacttccccagggagtgcatcctttgg
aaggatatcgagtatgtcaccaacgataatgtggatctgggcgagcttatgttttcactc
tgctatcttccaacggctggcaggctgaccatcaccatcataaaagcaaggaatttaaag
gcgatggacataacaggagcatcagatccctacgtgaaagtctcactgatgtgtgacggc
cggagactgaagaagaggaaaacctccaccaagaggaacacgcttaatcccgtttacaat
gaagccatagtcttcgacgtccctcccgagagcatcgaccagatccacttgtccatagcc
gtcatggactatgaccgtgtaggtcacaatgaggtcattggcgtgtgccaagtaggaaac
gaggctgagcggctgggcagagaccactggagtgagatgctgtcatatcctcggaagccc
atcgcacactggcactctctgatggagaaacgatga

DBGET integrated database retrieval system