KEGG   Mus musculus (mouse): 60525
Entry
60525             CDS       T01002                                 

Gene name
Acss2, 1110017C11Rik, ACAS, ACS, Acas1, Acas2, AceCS1, Acs1, aceCS
Definition
(RefSeq) acyl-CoA synthetase short-chain family member 2
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00010  Glycolysis / Gluconeogenesis
mmu00620  Pyruvate metabolism
mmu00630  Glyoxylate and dicarboxylate metabolism
mmu00640  Propanoate metabolism
mmu01100  Metabolic pathways
mmu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    60525 (Acss2)
   00620 Pyruvate metabolism
    60525 (Acss2)
   00630 Glyoxylate and dicarboxylate metabolism
    60525 (Acss2)
   00640 Propanoate metabolism
    60525 (Acss2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mmu01004]
    60525 (Acss2)
Enzymes [BR:mmu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     60525 (Acss2)
Lipid biosynthesis proteins [BR:mmu01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   60525 (Acss2)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Other DBs
NCBI-GeneID: 60525
NCBI-ProteinID: NP_062785
MGI: 1890410
Ensembl: ENSMUSG00000027605
Vega: OTTMUSG00000016058
UniProt: Q9QXG4
Position
2; 2 H1
AA seq 701 aa
MGLPEERRKSGSGSRAREETGAEGRVRGWSPPPEVRRSAHVPSLQRYRELHRRSVEEPRE
FWGNIAKEFYWKTACPGPFLQYNFDVTKGKIFTEWMKGATTNICYNVLDRNVHEKKLGDK
VAFYWEGNEPGETTKITYRELLVQVCQFSNVLRKQGIQKGDRVAIYMPMILELVVAMLAC
ARLGALHSIVFAGFSAESLCERILDSSCCLLITTDAFYRGEKLVNLKELADESLEKCREK
GFPVRCCIVVKHLGRAELGMNDSPSQSPPVKRPCPDVQICWNEGVDLWWHELMQQAGDEC
EPEWCDAEDPLFILYTSGSTGKPKGVVHTIGGYMLYVATTFKYVFDFHPEDVFWCTADIG
WITGHSYVTYGPLANGATSVLFEGIPTYPDEGRLWSIVDKYKVTKFYTAPTAIRMLMKFG
DDPVTKHSRASLQVLGTVGEPINPEAWLWYHRVVGSQRCPIVDTFWQTETGGHMLTPLPG
ATPMKPGSASFPFFGVAPAILNESGEELEGEAEGYLVFKQPWPGIMRTVYGNHTRFETTY
FKKFPGYYVTGDGCRRDQDGYYWITGRIDDMLNVSGHLLSTAEVESALVEHEAVAEAAVV
GHPHPVKGECLYCFVTLCDGHTFSPTLTEELKKQIREKIGPIATPDYIQNAPGLPKTRSG
KIMRRVLRKIAQNDHDLGDTSTVADPSVINHLFSHRCLTTQ
NT seq 2106 nt   +upstreamnt  +downstreamnt
atggggcttcccgaggagcggcgcaagagcggcagtggaagccgggctcgtgaggagacc
ggcgccgagggccgggtgcggggttggtccccgccgccggaggtcagacgctcggcgcac
gtcccctctctgcagcgctaccgcgagctgcaccggcgttctgtggaggagccacgggag
ttttggggaaacattgccaaggaattttactggaaaaccgcatgccctggcccattcctc
cagtacaactttgatgtgactaaagggaaaatattcactgagtggatgaaaggagcaact
acaaacatctgctacaacgtgctggatcgaaatgtccatgagaaaaaacttggcgacaaa
gttgctttttactgggagggcaatgagccaggggagaccaccaagatcacataccgtgaa
ctcctggtccaggtgtgtcagttcagcaatgttctccgtaaacagggcattcagaagggt
gaccgagtggccatctacatgcctatgatcttggaacttgtggtggctatgctggcatgc
gctcgccttggagctttgcactccattgtgtttgcaggcttctctgcagagtctctctgt
gaaaggatcttggattccagttgctgcctgctcatcactacagatgccttctacaggggg
gaaaaacttgtgaacctgaaggagctggctgatgagtccttggagaagtgccgagagaag
ggcttcccagtgagatgctgcattgtggtcaaacatctggggcgggcagagctgggcatg
aatgactcccccagccagtccccaccagttaagaggccatgtccagatgtccagatctgc
tggaacgaaggggttgacttatggtggcatgaactcatgcagcaggcaggagacgagtgt
gagcctgagtggtgtgatgctgaggacccactcttcatcttgtacaccagtggctccaca
ggcaaacctaagggtgtggtgcacacaattggaggctatatgctctatgtggctacaact
ttcaagtatgtgtttgatttccacccggaagatgtgttctggtgcacagcagacatcggc
tggatcactggtcattcctatgtcacctatgggccactggctaatggtgccactagtgtt
ttgtttgaggggatccccacatacccagatgaagggcgcttgtggagcattgtggacaaa
tacaaggtgaccaagttctacacggcaccaacagccatccggatgctcatgaagtttgga
gatgatcctgtcaccaagcatagccgggcatccctgcaggtgctgggcacagtaggtgaa
cccatcaaccctgaagcctggctatggtaccaccgggtagtaggttcccagcgctgcccc
attgtagacaccttctggcaaacagaaacaggtggccatatgctgacccctctccctggc
gccacacccatgaaacctggttctgcttctttcccattcttcggtgtagcgcctgcaatc
ctgaatgagtccggggaggagctggaaggggaagctgaaggttatctggtgttcaagcag
ccctggccagggatcatgcgcacagtctatgggaaccacacacggtttgagaccacctac
tttaagaagttccctggctactatgtgaccggagatggctgccgacgggatcaggatggc
tattactggatcacgggcaggattgatgacatgctcaatgtgtctggacatctcctgagt
acagcagaggtggaatcggcacttgtggaacacgaggctgtcgcagaggcagctgtggtg
ggccaccctcatcctgtgaagggcgaatgcctctactgctttgttaccttgtgtgatggc
cataccttcagccccacactcacagaggaactcaagaagcagattagagaaaagattggc
cccattgccacaccagactacatccagaatgcacctggcttgcctaaaacacgctcaggg
aaaatcatgaggcgagttctccggaagattgctcagaatgaccatgacctgggggataca
tctacggtggctgacccatctgtcatcaaccatctcttcagtcaccgctgcctgaccacc
cagtga

DBGET integrated database retrieval system