KEGG   Mus musculus (mouse): 60532
Entry
60532             CDS       T01002                                 

Gene name
Wtap, 2810408K05Rik, 9430038B09Rik
Definition
(RefSeq) Wilms tumour 1-associating protein
  KO
K22824  pre-mRNA-splicing regulator WTAP
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    60532 (Wtap)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    N6-methyltransferase complex
     60532 (Wtap)
SSDB
Motif
Pfam: Wtap ALMT DUF2000 SPACA9 UPF0242
Other DBs
NCBI-GeneID: 60532
NCBI-ProteinID: NP_001107004
MGI: 1926395
Ensembl: ENSMUSG00000060475
Vega: OTTMUSG00000034274
UniProt: Q9ER69
Position
17; 17 A1
AA seq 151 aa
MTNEEPLPKKVRLSETDFKVMARDELILRWKQYEAYVQALEGKYTDLNSNDVTGLRESEE
KLKQQQQESARRENILVMRLATKEQEMQECTTQIQYLKQVQQPSVAQLRSTMVDPAINLF
FLKMKGELEQTKDKLEQAQNELSAWKFTPDR
NT seq 456 nt   +upstreamnt  +downstreamnt
atgaccaacgaagaacctcttcctaaaaaggtccgactgagtgaaacagacttcaaagtt
atggcacgggatgagttaattctaagatggaaacaatatgaagcatatgttcaagctttg
gagggaaagtacacagatcttaattcaaacgatgtgactggtttaagggaatctgaagaa
aaactaaagcagcaacagcaggagtctgcacgcagggagaacattcttgtcatgcggcta
gcaaccaaagagcaggagatgcaagagtgcaccactcaaatccagtacctcaagcaagtt
cagcagccgagtgtggcccaactgagatcaacaatggtagacccagcaatcaacttgttt
ttcctaaaaatgaaaggtgaactggaacagactaaagacaaactggaacaagcccaaaat
gaactgagtgcctggaagtttacgcctgataggtaa

DBGET integrated database retrieval system