KEGG   Mus musculus (mouse): 60533
Entry
60533             CDS       T01002                                 

Gene name
Cd274, A530045L16Rik, B7h1, Pdcd1l1, Pdcd1lg1, Pdl1
Definition
(RefSeq) CD274 antigen
  KO
K06745  programmed cell death 1 ligand 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04514  Cell adhesion molecules (CAMs)
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    60533 (Cd274)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    60533 (Cd274)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    60533 (Cd274)
CD molecules [BR:mmu04090]
 Proteins
  60533 (Cd274)
SSDB
Motif
Pfam: Ig_3 V-set Ig_2 I-set ig C2-set_2 Ig_6 C1-set
Other DBs
NCBI-GeneID: 60533
NCBI-ProteinID: NP_068693
MGI: 1926446
Ensembl: ENSMUSG00000016496
Vega: OTTMUSG00000014904
UniProt: Q9EP73 Q3U472
Position
19; 19 C1
AA seq 290 aa
MRIFAGIIFTACCHLLRAFTITAPKDLYVVEYGSNVTMECRFPVERELDLLALVVYWEKE
DEQVIQFVAGEEDLKPQHSNFRGRASLPKDQLLKGNAALQITDVKLQDAGVYCCIISYGG
ADYKRITLKVNAPYRKINQRISVDPATSEHELICQAEGYPEAEVIWTNSDHQPVSGKRSV
TTSRTEGMLLNVTSSLRVNATANDVFYCTFWRSQPGQNHTAELIIPELPATHPPQNRTHW
VLLGSILLFLIVVSTVLLFLRKQVRMLDVEKCGVEDTSSKNRNDTQFEET
NT seq 873 nt   +upstreamnt  +downstreamnt
atgaggatatttgctggcattatattcacagcctgctgtcacttgctacgggcgtttact
atcacggctccaaaggacttgtacgtggtggagtatggcagcaacgtcacgatggagtgc
agattccctgtagaacgggagctggacctgcttgcgttagtggtgtactgggaaaaggaa
gatgagcaagtgattcagtttgtggcaggagaggaggaccttaagcctcagcacagcaac
ttcagggggagagcctcgctgccaaaggaccagcttttgaagggaaatgctgcccttcag
atcacagacgtcaagctgcaggacgcaggcgtttactgctgcataatcagctacggtggt
gcggactacaagcgaatcacgctgaaagtcaatgccccataccgcaaaatcaaccagaga
atttccgtggatccagccacttctgagcatgaactaatatgtcaggccgagggttatcca
gaagctgaggtaatctggacaaacagtgaccaccaacccgtgagtgggaagagaagtgtc
accacttcccggacagaggggatgcttctcaatgtgaccagcagtctgagggtcaacgcc
acagcgaatgatgttttctactgtacgttttggagatcacagccagggcaaaaccacaca
gcggagctgatcatcccagaactgcctgcaacacatcctccacagaacaggactcactgg
gtgcttctgggatccatcctgttgttcctcattgtagtgtccacggtcctcctcttcttg
agaaaacaagtgagaatgctagatgtggagaaatgtggcgttgaagatacaagctcaaaa
aaccgaaatgatacacaattcgaggagacgtaa

DBGET integrated database retrieval system