KEGG   Mus musculus (mouse): 60613
Entry
60613             CDS       T01002                                 

Symbol
Kcnq4
Name
(RefSeq) potassium voltage-gated channel, subfamily Q, member 4
  KO
K04929  potassium voltage-gated channel KQT-like subfamily member 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04725  Cholinergic synapse
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    60613 (Kcnq4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    60613 (Kcnq4)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   60613 (Kcnq4)
SSDB
Motif
Pfam: KCNQ_channel Ion_trans Ion_trans_2 DUF6526
Other DBs
NCBI-GeneID: 60613
NCBI-ProteinID: NP_001074611
MGI: 1926803
Ensembl: ENSMUSG00000028631
Vega: OTTMUSG00000008856
UniProt: Q9JK97
Position
4; 4 D2.1
AA seq 696 aa
MAEAPPRRLGLGPPPGDAPRAELVALTAVQSEQGEAGGGGSPRRLGLLGSPLPPGAPLPG
PGSGSGSACGGQRSSAAQKRYRRLQNWVYNVLERPRGWAFVYHVFIFLLVFSCLVLSVLS
TIQEHQELANECLLILEFVMIVVFGLEYIIRVWSAGCCCRYRGWQGRFRFARKPFCVIDF
IVFVASVAVIAAGTQGNIFATSALRSMRFLQILRMVRMDRRGGTWKLLGSVVYAHSKELI
TAWYIGFLVLIFASFLVYLAEKDANSDFSSYADSLWWGTITLTTIGYGDKTPHTWLGRVL
AAGFALLGISFFALPAGILGSGFALKVQEQHRQKHFEKRRMPAANLIQAAWRLYSTDTSR
AYLTATWYYYDSILPSFRELALLFEHIQRARNGGLRPLEVRRAPVPDGAPSRYPPVATCH
RPGSASFCPGESSRMGIKDRIRISSSQKRTGPSKQHLAPPPIPTSPSSEQVGEASSPSKV
QKSWSFNDRTRFRASLRLKPRCSAEEGPSEEVAEEKSYQCELTVDDVMPAVKTVIRSVRI
LKFLVAKRKFKETLRPYDVKDVIEQYSAGHLDMLGRIKSLQARVDQIVGRGPGDRKTREK
GDKGPSDTEAVDEISMMGRVVKVEKQVQSIEHKLDLLLGFYSRCLRSGTSASLGTVQVPL
FDPDITSDYHSPVDHEDISVSAQTLSISRSVSTNMD
NT seq 2091 nt   +upstreamnt  +downstreamnt
atggccgaggcccccccgcgccgcctcggcctgggccccccgcccggggacgccccccgc
gcggagttggtggcgctcacggccgtgcagagtgaacagggcgaggcgggcgggggcggc
tctccgcgtcgcctcggccttctgggcagccccctgccgccgggcgcgcccctccctggg
ccgggctccggctcgggctccgcctgcggcggccagcgctcctccgccgcgcagaagcgc
taccgccgcctgcagaactgggtctacaacgtgctggagcggccccgcgggtgggccttc
gtctaccacgtcttcatatttttgctagtcttcagctgcctggtgctgtctgtactgtcc
accatccaggagcaccaggaacttgccaacgagtgtctccttatcttggaattcgtgatg
attgtggtctttggcttggagtatataatccgtgtctggtcggccggatgctgttgtcgc
tacagaggatggcagggacgctttcgcttcgccaggaaacccttctgtgtcatcgacttc
atcgtgttcgtggcctcggtggcagtgatagctgcgggcacacaaggcaacatctttgct
acgtccgcgttgcgcagtatgcgcttcctacagatcctgcgcatggtgcgtatggatcgc
cgcggtggcacctggaagctgttgggatccgtggtctatgcgcacagtaaggagctgatc
accgcctggtacatcgggttcctggtgctcatctttgcctctttcctggtctacctggct
gagaaggatgccaactctgacttctcctcctatgccgactcgctctggtgggggacgatc
acactgacgaccattggctatggtgacaagacgccacatacatggctgggcagggttctg
gctgccggcttcgccttactgggcatctccttctttgccctgcctgccggcatcctgggc
tctggctttgccctgaaggtccaggagcagcacaggcagaagcactttgagaagcgcagg
atgccagcagctaatctcatccaggctgcgtggcgcctgtactccacggacacaagccgg
gcctatttgacagccacctggtattactatgacagcattctcccatctttcagagagctg
gccctcttgtttgagcacatacaacgggcccgcaatgggggcttacggcccctggaggtg
aggcgggcgccagtacctgatggagcgccctctcgctacccgcccgttgccacctgccac
cggccaggcagtgcctccttctgccctggggaaagcagccggatgggcatcaaagaccga
atccgcataagcagctcccagaagcggacaggcccctccaagcagcatctggcccctccg
ccgattcccacctcgccaagcagtgagcaggtgggcgaggcatccagccccagcaaggtg
cagaaaagctggagcttcaatgaccgcacccgcttccgggcctctctaagactcaagcct
cgctgctctgctgaggagggcccctcagaggaagtggccgaggagaagagctaccagtgt
gagcttacggtggatgatgtcatgcctgctgtgaagacggtcatccgttctgtcaggatt
ctgaagttcctggtagccaaaaggaaattcaaggagacgctgcggccatatgatgtgaag
gatgtcattgagcagtattcagcaggacacctggacatgctgggacgaatcaagagcctg
caagcccgggtggaccaaattgtgggtcggggccctggggaccgcaagactcgggagaag
ggcgataagggtccttcagacacggaggcagtggatgaaatcagcatgatggggcgcgta
gtcaaggtggaaaagcaggtgcagtccatcgaacataagttggatctgctgctgggcttc
tactcgcgctgcctccgctctggcacctcggccagcctgggcactgtgcaagtgccgctc
ttcgaccccgacatcacctcggactaccacagccctgtagaccacgaggacatctctgtc
tccgcacagacgctcagcatctctcgctcagtcagcaccaacatggactga

DBGET integrated database retrieval system