KEGG   Mus musculus (mouse): 622320
Entry
622320            CDS       T01002                                 

Gene name
Kctd21, EG622320
Definition
(RefSeq) potassium channel tetramerisation domain containing 21
  KO
K21922  BTB/POZ domain-containing protein KCTD21
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    622320 (Kctd21)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     622320 (Kctd21)
SSDB
Motif
Pfam: BTB_2 BTB_3 BTB
Other DBs
NCBI-GeneID: 622320
NCBI-ProteinID: NP_001034128
MGI: 3643121
Ensembl: ENSMUSG00000044952
Vega: OTTMUSG00000029536
UniProt: Q3URF8 B2RTJ2
Position
7; 7 E1
AA seq 260 aa
MSDPITLNVGGKLYTTSLATLTSFPDSMLGAMFSGKMPTKRDSQGNCFIDRDGKVFRYIL
NFLRTSHLDLPEDFQEMGLLRREADFYQVQPLIEALQEKEVELSKAEKNAMLNITLKQRV
QTVHFTVREAPQIYSLSSSSMEVFNANIFSTSCLFLKLLGSKLFYCSNGNLSSITSHLQD
PNHLTLDWVANVEGLPEEEYTKQNLKRLWVVPANKQINSFQVFVEEVLKIALSDGFCIDS
SHPHALDFMNNKIIRLIRYR
NT seq 783 nt   +upstreamnt  +downstreamnt
atgtctgaccccattacactgaatgttggggggaagctctacacaacctcactggcaacc
ctgaccagcttccccgactccatgctgggggccatgttcagtgggaagatgcccaccaag
agggacagccagggtaactgcttcattgaccgtgatggcaaagtgttccgctatatcctc
aacttcctgcggacctctcacctggatctgccagaggacttccaggagatgggtctgctg
cgcagggaagccgacttctaccaggtacagcccctgatcgaggccctgcaggaaaaagag
gtagaactctccaaggcggagaagaatgccatgcttaacatcaccctgaagcagcgcgtg
cagacggtccacttcaccgtgcgggaggcaccacagatctacagcctgtcgtcttccagc
atggaggtgttcaacgccaacatcttcagcacgtcctgcctcttcctcaaactccttggc
tctaagctcttctactgctccaatggcaatctctcctccatcaccagccacttgcaggac
cctaaccatctgactcttgactgggtagccaatgtggaaggccttccagaggaagagtac
accaagcagaacctgaaaaggctgtgggtggtccctgccaacaagcagatcaacagcttc
caggtctttgtggaggaggtgctgaagatcgctctgagtgatgggttctgcattgactct
tcccacccacacgctctggacttcatgaacaataagatcattcggttaatccggtacagg
taa

DBGET integrated database retrieval system