KEGG   Mus musculus (mouse): 622402
Entry
622402            CDS       T01002                                 

Gene name
Akr1c12, AI266976, Akra
Definition
(RefSeq) aldo-keto reductase family 1, member C12
  KO
K13374  aldo-keto reductase family 1 member C13 [EC:1.1.1.218]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    622402 (Akr1c12)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.218  morphine 6-dehydrogenase
     622402 (Akr1c12)
SSDB
Motif
Pfam: Aldo_ket_red
Other DBs
NCBI-GeneID: 622402
NCBI-ProteinID: NP_038805
MGI: 1351661
Ensembl: ENSMUSG00000021211
Vega: OTTMUSG00000027685
UniProt: Q9JLI0
Position
13; 13 A1
AA seq 323 aa
MSSKQHYVKLNDGHLIPALGFGTYKPKEVPKSKSLEAACLALDVGYRHVDTAYAYQVEEE
IGQAIQSKIKAGVVKREDLFITTKLWCGCFRPELVKPALEKSLKSLQLDYVDLYLIHYPV
PMKPGDNESPLDENGKFLLDTVDFCDTWERLEECKDAGLVKSIGVSNFNHRQLERILNKP
GLKYKPVCNQVECHLYLNQSKLLDYCKSKDIVLVAYGALGTQRYKEWVDQNSPVLLNDPV
LCDVAKRNKRSPALIALRYLFQRGIVPLAQSFKENEMRENLQVFEFQLSPEDMKTLDGLN
KNFRYLPAEFLADHPEYPFSEEY
NT seq 972 nt   +upstreamnt  +downstreamnt
atgagctccaaacagcactatgtcaaactaaacgatggccacttaattcctgccctgggc
tttggcacctataaacccaaggaggttcccaagagtaagtcactggaggctgcatgccta
gctctagatgttgggtaccgccatgttgatactgcttatgcataccaagtagaagaggag
ataggacaggccattcaaagcaagattaaagctggggttgtaaagagagaagacctgttc
atcactacaaagctttggtgcggttgctttcgaccagagctggtcaagcctgctttggaa
aaatcactgaaaagccttcagctggattatgttgatctttaccttatacattacccagtg
ccaatgaagccaggggataatgaatctccattagatgagaacgggaaatttctattggac
actgtggatttctgtgacacatgggagaggttggaggagtgtaaggatgcaggattggtc
aagtccattggggtgtccaactttaaccacaggcagctagagagaatcctcaacaagcca
ggactgaagtacaaacctgtctgcaaccaggttgaatgtcatctctatttgaaccagagt
aagctattggattactgcaagtcaaaagacattgttctcgttgcttacggtgctctgggg
acccagcgatataaagaatgggtggaccagaactccccagttctcttgaacgatccagtt
ctttgtgatgtggccaaaaggaacaagcgaagccctgccctaattgcacttcgatacctg
tttcaacgtgggattgtgcccctggcccagagtttcaaagagaatgagatgagagagaat
ttgcaggtttttgaatttcagttgtcccctgaggacatgaaaacactagatggcctgaac
aaaaactttcgataccttccagcagagttccttgctgaccacccagagtatccattttca
gaggaatattaa

DBGET integrated database retrieval system