KEGG   Mus musculus (mouse): 623503Help
Entry
623503            CDS       T01002                                 

Gene name
Prlh, EG623503
Definition
(RefSeq) prolactin releasing hormone
  KO
K05269  Prolactin-releasing peptide
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    623503 (Prlh)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Prolactin_RP
Motif
Other DBs
NCBI-GeneID: 623503
NCBI-ProteinID: NP_001095117
MGI: 3644668
Ensembl: ENSMUSG00000090550
Vega: OTTMUSG00000048409
UniProt: G3UWC3
Position
1; 1 D
AA seq 86 aa AA seqDB search
MAPRTWLLCLLLLGLVLPGASSRAHQHSMETRTPDINPAWYTGRGIRPVGRFGRRRAALR
DVTGPGLRCRLSCFPLDGSAKFSHSS
NT seq 261 nt NT seq  +upstreamnt  +downstreamnt
atggcaccgaggacctggcttctgtgcttgctgctgctaggcttagtcctcccaggagct
tccagccgagcccaccagcactccatggagacccgcacccctgacatcaatcctgcctgg
tacacgggtcgtgggatcaggcctgtgggccgcttcgggaggaggagggcagccctgagg
gatgtcaccggacctggcctgcggtgccggctaagctgcttcccactggatggaagtgcc
aagttctctcacagctcatga

DBGET integrated database retrieval system