KEGG   Mus musculus (mouse): 623781Help
Entry
623781            CDS       T01002                                 

Gene name
Gm14137
Definition
(RefSeq) predicted gene 14137
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: BORG_CEP
Motif
Other DBs
NCBI-GeneID: 623781
NCBI-ProteinID: NP_001034312
MGI: 3651144
Ensembl: ENSMUSG00000055926
Vega: OTTMUSG00000015762
UniProt: Q8CE97 B2RX56
Position
2; 2 E5
AA seq 175 aa AA seqDB search
METWRKGSFRNASFFKRITLGRPRRLHRQGSILSQASTAGGDHEEYSNREVIRELQGRPD
GRRLPLWGDEHPRATLLAPPKPPRLYRESSSCPNILEPPASYTAGYSATLPSAISLTGPL
HQCSEEALSDTPHFPRTPTPDLSDPFLSFKVDLGLSLLEEVLQILKEQFPSEPHF
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atggagacctggcggaaaggctccttccgcaatgcctcctttttcaagcgaatcaccctg
gggcggccacggagactgcatcgacagggcagcatacttagccaggccagcactgctggt
ggtgaccatgaggagtacagcaaccgggaagtcatccgagaactgcaagggaggccagac
ggccggcgtctgcccttgtggggggatgagcatccccgagccaccctactggccccaccc
aagcccccacgcctctaccgagagagctccagctgccccaacattctggagcccccagca
agctacacagctggctactcggccaccctgccttcagcaatctccctgacagggccgctt
caccagtgctcagaggaggccctttcggacactccccacttcccgaggacacctactccg
gacctcagtgaccctttcctctccttcaaagtggacctggggctttcacttctggaagaa
gttctgcagattctaaaggagcaattcccaagcgagccccacttctga

DBGET integrated database retrieval system