KEGG   Mus musculus (mouse): 625068
Entry
625068            CDS       T01002                                 

Gene name
Vmn2r84, EG625068
Definition
(RefSeq) vomeronasal 2, receptor 84
  KO
K04613  vomeronasal 2 receptor
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    625068 (Vmn2r84)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Vomeronasal pheromone
    625068 (Vmn2r84)
SSDB
Motif
Pfam: 7tm_3 ANF_receptor NCD3G
Other DBs
NCBI-GeneID: 625068
NCBI-ProteinID: NP_001074917
MGI: 3643367
Ensembl: ENSMUSG00000070601
Vega: OTTMUSG00000038222
UniProt: D3YWE3
Position
10; 10 D3
AA seq 849 aa
MKKMCALTISFLLLKFSLILCCLKEPICFWRIKSSEYNDGNLQSECGYFVWTMKKLMKDD
FYNVWLDFRIPASEYEFVLVMFFATNEINKNPDLLPNTSLVFSVMAGNCQDSLGNLDIQY
MLTNDSLNYVNYVCDIDDSCAIGLTGPSWKTSLKLAIDSWTPTVFFGPFNPKLSDHDHFP
YVHQIATKDTHLSHGMVSLMLHFRWTWIGLVISDDDQGVQLHSDLREESQRHGICLAFVN
VIPETMKIYMTRGNMYDKQIMTSSAKVVIIYGEMNSTLEISFRRWAYLGARRIWITTSQW
DVITNKKDFSLDLFHGTVTFAHHKGWIAKFKNFMQTMNTSKYPINISQSVLRWNYFNCSV
SKNSIKMDHFTCENPLELTALHNYDMALSDEGYNLYNAVYAVAHTYHEHILQQVESQKMA
EDKGEYTECQQLAPLLKTRVFTNPVGEMVNMNHREYQCAEYDIFIIWNFPQGLGLKVKIG
SYFPCFPQSQQLHISEDLEWATGGTSVPSSMCSVTCTPGFRKIHQKETADCCFDCVQCPE
NEVSNETDMEQCVRCPDDQYANLEQTHCLQRAVSFLAYEDPLGMALGCMALSFTAITILV
LVTFVKYRDTPIVKANNCILSYILLISLVFCFLCSLLFIGHPNQVTCILQQTTFGLFFTV
AVSTVLAKTITVVMAFKLTTPGGRMRGMMMMTGAPKLVIPICTLIQLVLCGIWLLTSPPF
IDRDIQSEHGKTVIFCNTGSVLAFHVVLGYLGSLALGSFTVAFLARNLPDRFNEAKFLTF
SMLVFCSVWITFLPVYHSTRGKVMVVVEVFSILASSAGLLGCIFVPKCYAILVRPDSNCI
QKYKGKLLY
NT seq 2550 nt   +upstreamnt  +downstreamnt
atgaagaaaatgtgtgctttaactatttcatttttgcttctgaagttttctctcatcttg
tgttgtttgaaagaacccatttgcttttggaggataaaaagtagtgaatataatgatgga
aatttgcaaagtgagtgtggttatttcgtttggacaatgaagaaacttatgaaagatgat
ttttataatgtatggttggattttagaataccagcaagtgaatacgagtttgttctggta
atgttttttgctactaatgagatcaacaagaatcctgatcttttaccaaacacctctttg
gtattctctgtcatggctggtaactgtcaagattcattgggaaatctggatatacaatat
atgctaacaaatgacagcctgaattatgttaattatgtctgtgacatagatgattcatgt
gccataggccttacaggaccatcatggaaaacatccttaaaactggcaattgattcttgg
acaccaacggttttctttggaccatttaatcctaaactgagtgaccatgaccattttccc
tatgtccatcagatagccaccaaggacacacatttgtcccatggcatggtctccttgatg
cttcattttagatggacttggataggactggtcatctcagatgatgaccagggtgttcag
cttcattcagatttaagagaagaaagccaaaggcacggtatttgtttagcttttgtgaat
gtgatcccagaaaccatgaagatatacatgacaaggggtaatatgtatgataaacaaatt
atgacatcttcagcaaaggttgttatcatttatggtgaaatgaactctacactagaaatt
agctttagaagatgggcatatttaggtgctcggaggatctggatcacaacctcacaatgg
gatgttatcacaaataaaaaagatttcagccttgatctcttccatggtactgtcactttt
gcacaccacaaaggttggattgctaaatttaagaattttatgcaaacaatgaacacttcc
aaatacccaataaacatttctcagtcagtactgaggtggaattattttaattgttcagtc
tctaagaacagcattaaaatggatcatttcacatgcgaaaacccattagaattgacagca
ctgcacaactatgacatggccctgagtgatgaaggttacaatttgtataatgctgtttat
gctgtggcccatacctaccatgagcacattcttcaacaagtagagtctcaaaaaatggca
gaagacaaaggagaatacacagaatgtcagcagttggctcccttgctgaaaactagggta
tttactaaccctgttggagaaatggtgaacatgaatcatagggaatatcagtgtgcagag
tatgacattttcatcatttggaattttccacaaggccttggattaaaagtgaaaatagga
agctattttccttgtttcccacagagtcaacaacttcatatatctgaagatttggaatgg
gccacaggaggaacatcagtaccctcctccatgtgcagtgtgacatgtactcctggattc
aggaaaattcatcagaaagaaacagcagactgctgctttgattgtgttcagtgcccagaa
aatgaggtttccaatgaaacagatatggaacagtgtgtgagatgtccagatgatcaatat
gccaacttagagcaaacccattgcctccaaagagctgtgtcatttctggcttatgaagat
ccattggggatggctctgggctgcatggcactgtccttcacagccatcacaattctagta
ctagtcacttttgtgaagtacagggatactcccattgtgaaggccaataactgcattctc
agctacatcctactcatctctctagtcttctgctttctctgctcattgctcttcattgga
catcccaaccaggtcacctgcatcctgcagcagaccacatttggactatttttcactgtg
gctgtttctacagtgttggccaaaacaataactgtggtcatggctttcaagctcactact
ccaggaggaaggatgagagggatgatgatgatgacaggggcacctaagttggtcattccc
atttgtaccctaatccaacttgttctctgtggaatctggttgttaacatctcctcccttt
attgacagagatatacaatctgaacatgggaagactgtcattttttgcaacacaggctct
gtccttgccttccatgttgtcctgggatacttgggttccttggctctggggagcttcact
gtggctttcctggctaggaaccttcctgacagattcaatgaagccaagttcctaactttc
agcatgctggtgttctgcagtgtctggatcaccttcctccctgtctaccacagcaccagg
gggaaggtcatggtggttgtggaggtcttttccatcttggcttctagtgcagggttgcta
gggtgtatctttgtcccaaagtgttatgctattttagttagaccagattcaaattgtata
cagaagtacaaaggtaaattgctttactga

DBGET integrated database retrieval system