KEGG   Mus musculus (mouse): 625109Help
Entry
625109            CDS       T01002                                 

Gene name
Vmn2r86, EG625109
Definition
(RefSeq) vomeronasal 2, receptor 86
  KO
K04613  vomeronasal 2 receptor
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    625109 (Vmn2r86)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Vomeronasal pheromone
    625109 (Vmn2r86)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_3 ANF_receptor NCD3G
Motif
Other DBs
NCBI-GeneID: 625109
NCBI-ProteinID: NP_001096835
MGI: 3649066
Ensembl: ENSMUSG00000092162
Vega: OTTMUSG00000038224
UniProt: G5E8Y4
Position
10; 10 D3
AA seq 848 aa AA seqDB search
MKKMCALTISFLLLKFSLLLCCLKEPICFWRIKSSEYNDGDLQSECGYFLWTMKKLMKDD
FYNVRLDFRIPASEYEFVLVMFFATDEINKNPDLLPNTSLVFSVMAGKCQDSLGNLDIQY
MLINDSLNYVNYVCDIDDSCAIGLTGPSWKTSLKLAIDSWTPTVFFGPFNPNLSDHDRFP
NVHQIATKDTHLSHGMVSLMLHFRWTWIGLVISDDDQGIQLHSDLREESQRHGICLAFVN
VIPETMKIYMTRGNMYDKQIMTSSAKVVIIYGEMNSTLEISFRRWVYLGARRIWITTSQW
DVITNKKDFSLDLFHGTVTFAHHKGWIAKFKNFMQTMNTSKYPINISQSILRWNYFNCSV
SKNSIKMDHFTCKNPLELTALHNYDMALSDEGYNLYNAVYAVAHTYHEHILHQVESQKMV
EDKGKYTECQQLALLLKTRVFTNPVGEMVNMNHREYQCAEYDIFIIWNFPQGLGLKVKIG
SYFPCFPWSQQLHISEDLEWATGGTSVPSSICSVTCTPGFRKIHQKETADCCFDCVQCPE
NEVSNETVDMEQCVRCPDDKYANLEQMHCLQRAVSFLAYEDPLGMALGCMALSFTAITIL
VLVTFVKYKDTPIVKANNCILSYILLISLVFCFLCSLLFIGHPNQVTCILQQTTFGLFFT
VAVSTVLAKTITVVMAFKLTTPGKRMRGMMTGAPKLVIPICTLIQLVLCGIWLLTSPPFI
ERDIQSEHGKTVIFCNKGSVLSFHVVLGYLGSLALGSFIVAFLARNLPDRFNEAKFLTFS
MLVFCSVWITFLPVYHSTRGKVMVVVEVFSILASSAGLLGCIFVPKCYVILVRPDSNYIQ
KFKGKLLY
NT seq 2547 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaatgtgtgctttaactatttcatttttgcttctgaagttttctctccttttg
tgttgtttgaaagaacccatttgcttttggaggataaaaagtagtgaatataatgatgga
gatttgcaaagtgagtgtggttatttcctttggacaatgaagaaacttatgaaagatgat
ttttataatgtaaggttggattttagaataccagcaagtgaatatgagtttgttctggta
atgttttttgctactgatgagatcaacaagaatcctgatcttttaccaaacacctctttg
gtattctctgtcatggctggtaaatgtcaagattcattgggaaatctggacatacaatat
atgctaataaatgacagtctgaattatgttaattatgtctgtgacatagatgattcatgt
gccataggccttacaggaccatcatggaaaacatccttaaaactggcaattgattcttgg
acaccaacggttttctttggaccatttaatcctaacctgagtgaccatgaccgttttccc
aatgtccatcagatagccaccaaggacacacatttgtcccatggcatggtctccttgatg
cttcattttagatggacttggataggactggtcatctcagatgatgaccagggtattcag
cttcattcagatttaagagaagaaagccaaaggcatggtatttgtttagcttttgtgaat
gtgatcccagaaaccatgaagatatacatgacaaggggtaatatgtatgataaacaaatt
atgacatcttcagcaaaggttgttatcatttatggtgaaatgaactctacactagaaatt
agctttagaagatgggtatatttaggtgctcggaggatctggatcacaacctcacaatgg
gatgttatcacaaataaaaaagatttcagccttgatctcttccatggtactgtcactttt
gcacaccacaaaggttggattgctaaatttaagaattttatgcaaacaatgaacacttcc
aaatacccaataaacatttctcagtcaatactgaggtggaattattttaattgttcagtc
tctaagaacagcattaaaatggatcatttcacatgcaaaaacccattagaattgacagca
ctgcacaactatgacatggccctgagtgatgaaggttacaatttgtataatgctgtttat
gctgtggcccacacctaccatgaacacattcttcatcaagtagagtctcaaaaaatggtg
gaagacaaaggaaagtatacagaatgtcagcagttggctctcttgctgaaaactagggta
tttactaaccctgttggagaaatggtgaacatgaatcatagggaatatcagtgtgcagag
tatgacattttcatcatttggaattttccacaaggccttggattaaaagtgaaaatagga
agctattttccttgtttcccatggagtcaacaacttcatatatctgaagatttggaatgg
gccacaggaggaacatcagtaccctcctccatttgcagtgtgacatgtactcctggattc
aggaaaattcatcagaaagaaacagcagactgctgctttgattgtgttcagtgcccagaa
aatgaggtttccaatgaaacagtagatatggaacagtgtgtgaggtgtccagatgataaa
tatgccaatttagagcaaatgcactgcctccaaagagctgtgtcatttctggcttatgaa
gatccattggggatggctctgggctgcatggcactgtccttcacagccatcacaattcta
gtactagtcacttttgtgaagtacaaggatactcccattgtgaaggccaataactgcatt
ctcagctacatcctactcatctctctagttttctgctttctctgctcattgctcttcatt
ggacatcccaaccaggtcacctgcatcctgcagcagaccacatttggactatttttcact
gtggctgtttctacagtgttggccaaaacaataactgtggtcatggctttcaagctcact
actccaggaaaaaggatgagagggatgatgacaggggcacctaagttggtcattcccatt
tgtaccctaatccaacttgttctctgtggaatctggttgttaacatctcctccatttatt
gaaagagatatacaatctgaacatgggaagactgtcattttttgcaacaaaggctctgtc
ctttccttccatgttgtcctgggatacttgggttccttggctctggggagcttcattgtg
gctttcctggctaggaaccttcctgacagattcaatgaagccaagttcctaactttcagc
atgctggtgttctgcagtgtctggatcaccttccttcctgtctaccacagcaccaggggg
aaggtcatggtggttgtggaggtcttttccatcttggcttctagtgcagggttgctaggg
tgtatctttgtcccaaagtgttatgttattttagttaggccagattcaaattatatacag
aagttcaaaggtaaattgctttattga

DBGET integrated database retrieval system