KEGG   Mus musculus (mouse): 625131
Entry
625131            CDS       T01002                                 

Gene name
Vmn2r87, EG625131
Definition
(RefSeq) vomeronasal 2, receptor 87
  KO
K04613  vomeronasal 2 receptor
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    625131 (Vmn2r87)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Vomeronasal pheromone
    625131 (Vmn2r87)
SSDB
Motif
Pfam: 7tm_3 ANF_receptor NCD3G PNTB
Other DBs
NCBI-GeneID: 625131
NCBI-ProteinID: NP_001096836
MGI: 3645796
Ensembl: ENSMUSG00000091511
Vega: OTTMUSG00000038225
UniProt: E9PZX4
Position
10; 10 D3
AA seq 848 aa
MKKMCVLTTSFLFLKFSLILCCLTEPICFWRIKDSEYNDGELQSECGFFLWTMEKPMEDD
FYNVRFDFRIPASEYEFVLVMFFATDEINKNPDLLPNTSLVFSVIGGKCQDSLGLLGEEY
ILINDSLNYVNYVCKADDTCVIDLTGPSWKTSLKLAIDSWTPKVFFGPFNPNLSDHDRFP
YVHQVATKDTHLSHGMVSLMLHFRWTWIGLVISDDDQGIQLHSDLREESQRHGICLAFVN
VIPETMKIYMTRGNMYDKQIMTSSAKVVIIYGEMNSTLEISFRRWVYLGARRIWITTSQW
DVITNKKDFSLDLFHGTVTFAHHKGWIAKFKNFMQTMNTSKYPINISQSVLRWNYFNCSV
SKNSIKMDHFTCKNPLEWTALHNYDMALSDEGYNLYNAVYAVAHAYHEHILHQVESQKMA
EDKGKYTECQQLAPLLKTRVFTNPVGELVNMNQREYQCAEYDIFIIWNFPQGLGLKVKIG
NYFPCFPRSQQLHISEDLEWVTGGTLVPSSMCSVTCTPGFRKIHQKETADCCFDCVQCPE
NEVSNETADMEQCVRCPDDKYANLEQSHCLQRTVSFLAYEDPLGMVLGSMALSSSAITIL
VLVTFMKYKDTPIVKANNCILSYILLISLVFCFLCSLLFIEHPNQVTCILQQTTFGLFFT
VAVSTVLAKTITVVMAFKLTTPGKRMRGMMTGAPKLVIPICTLIQLVLCGIWLLTSPPFI
DRDIQSEHGKTVIFCNKGSVIAFHVVLGYLGSLALGSFTVAFLARNLPDRFNEAKFLTFS
MLVFCSVWITFLPVYHSTRGKIMVVVEVFSILASSAGLLGCIFVPKCYVILVRPDSNFIQ
KYKGKLLY
NT seq 2547 nt   +upstreamnt  +downstreamnt
atgaagaaaatgtgtgttttaactacttcatttttatttctgaagttttctctcatcttg
tgctgtttgacagaacccatttgcttttggaggataaaagatagtgaatataatgatgga
gagttgcaaagtgagtgtggtttcttcctttggacaatggagaaacctatggaagatgat
ttttataatgtaaggtttgattttagaataccagcaagtgaatacgagtttgttctggta
atgttttttgctactgatgagatcaacaagaatcctgatcttttaccaaacacatctttg
gtattctctgtcattggtggtaaatgtcaagattctttgggacttctgggcgaagaatat
atactaataaatgacagtctgaattatgttaattatgtctgtaaagcagatgatacatgt
gtcatagaccttacaggaccatcatggaaaacatccttaaaactggcaattgattcttgg
acaccaaaggttttctttggaccatttaatcctaacctaagtgaccatgaccggtttccc
tatgtccatcaggtagccaccaaggacacacatttgtcccatggcatggtctccttgatg
cttcattttagatggacttggataggactggtcatttcagatgatgaccagggtattcag
cttcattcagatttaagagaagaaagccaaaggcacggtatttgtttagcttttgtgaat
gtgatcccagaaaccatgaagatatacatgacaaggggtaatatgtatgataaacaaatt
atgacatcttcagcaaaggttgttatcatttatggtgaaatgaactctacactagaaatt
agctttagaagatgggtatatttaggtgctcggaggatctggatcacaacctcacaatgg
gatgttatcacaaataaaaaagatttcagccttgatctcttccatggtactgtcactttt
gcacaccacaaaggttggattgctaaatttaagaattttatgcaaacaatgaacacttcc
aaatacccaataaacatttctcagtcagtactgaggtggaattattttaattgttcagtc
tctaagaacagcattaaaatggatcatttcacatgcaaaaacccattggaatggacagca
ctgcacaactatgacatggccctgagtgatgaaggttacaatttgtataatgctgtttat
gctgtggcccacgcctaccatgaacacattcttcatcaagtagagtctcaaaaaatggca
gaagacaaaggaaaatacacagaatgtcagcagttggctcccttgctgaaaactagagta
tttactaatcctgttggagaactggtgaacatgaatcaaagggaatatcagtgtgcagag
tatgacattttcatcatttggaattttccacaaggccttggattaaaagtgaaaatagga
aactattttccttgtttcccacggagtcaacaactacatatatccgaagatttagaatgg
gtcacaggaggaacattagtaccctcctccatgtgcagtgtgacatgtactcctggattc
aggaaaattcatcagaaagaaacagcagactgctgctttgattgtgttcagtgcccagaa
aatgaggtttccaatgaaacagcagatatggaacagtgtgtgaggtgtccagatgataag
tatgccaacttagagcaatcccactgcctccaaagaactgtgtcatttctggcttatgaa
gatccattggggatggttctaggaagcatggcactgtcctcctcagccatcacaattcta
gtactagtcacttttatgaagtacaaggatactcccattgtgaaggccaataactgcatt
ctcagctacatcctactcatctctctagtcttttgctttctctgctcattgctcttcatt
gaacatcccaaccaggtcacctgcatcctgcagcagaccacatttggactatttttcact
gtggctgtttctacagtgttggccaaaacaataactgtggtcatggctttcaagctcact
actccaggaaaaaggatgagagggatgatgacaggggcacctaagttggtcattcccatt
tgtaccctaatccaacttgttctctgtggaatctggttgttaacatctcctccctttatt
gacagagatatacaatctgaacatgggaagactgtcattttttgcaacaaaggctctgtc
attgccttccatgttgtcctgggatacttgggttccttggctctggggagcttcactgtg
gctttcctggctaggaaccttcctgacagattcaatgaagccaagttcctaactttcagc
atgctggtgttctgcagtgtctggatcaccttccttcctgtctaccacagcaccaggggg
aagatcatggtggttgtggaggtcttctccatcttggcttctagtgcagggttgctaggg
tgtatctttgtcccaaagtgttatgttattttagttagaccagattcaaattttatacag
aagtacaaaggtaaattgctttattga

DBGET integrated database retrieval system