KEGG   Mus musculus (mouse): 625249Help
Entry
625249            CDS       T01002                                 

Gene name
Gpx4, GPx-4, GSHPx-4, PHGPx, mtPHGPx, snGPx
Definition
(RefSeq) glutathione peroxidase 4
  KO
K05361  phospholipid-hydroperoxide glutathione peroxidase [EC:1.11.1.12]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00480  Glutathione metabolism
mmu01100  Metabolic pathways
mmu04216  Ferroptosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    625249 (Gpx4)
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    625249 (Gpx4)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.12  phospholipid-hydroperoxide glutathione peroxidase
     625249 (Gpx4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-GeneID: 625249
NCBI-ProteinID: NP_032188
MGI: 104767
Ensembl: ENSMUSG00000075706
Vega: OTTMUSG00000019111
UniProt: O70325
Structure
PDB: 

Position
10 C1; 10 39.72 cM
AA seq 197 aa AA seqDB search
MSWGRLSRLLKPALLCGALAAPGLAGTMCASRDDWRCARSMHEFSAKDIDGHMVCLDKYR
GFVCIVTNVASQUGKTDVNYTQLVDLHARYAECGLRILAFPCNQFGRQEPGSNQEIKEFA
AGYNVKFDMYSKICVNGDDAHPLWKWMKVQPKGRGMLGNAIKWNFTKFLIDKNGCVVKRY
GPMEEPQVIEKDLPCYL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgagctggggccgtctgagccgcttacttaagccagcactgctgtgcggggctctggct
gcgcctggtctggcaggcaccatgtgtgcatcccgcgatgattggcgctgtgcgcgctcc
atgcacgaattctcagccaaggacatcgacgggcacatggtctgcctggataagtacagg
ggtttcgtgtgcatcgtcaccaacgtggcctcgcaatgaggcaaaactgacgtaaactac
actcagctagtcgatctgcatgcccgatatgctgagtgtggtttacgaatcctggccttc
ccctgcaaccagtttgggaggcaggagccaggaagtaatcaagaaatcaaggagtttgca
gccggctacaacgtcaagtttgacatgtacagcaagatctgtgtaaatggggacgatgcc
cacccactgtggaaatggatgaaagtccagcccaagggcaggggcatgctgggaaatgcc
atcaaatggaactttaccaagtttctcattgataagaacggctgcgtggtgaagcgctat
ggtcccatggaggagccccaggtgatagagaaggacctgccgtgctatctctag

DBGET integrated database retrieval system