KEGG   Mus musculus (mouse): 626682
Entry
626682            CDS       T01002                                 

Gene name
Defa28, EG626682, Gm6696
Definition
(RefSeq) defensin, alpha, 28
  KO
K05230  defensin, alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
mmu05150  Staphylococcus aureus infection
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    626682 (Defa28)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    626682 (Defa28)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    626682 (Defa28)
SSDB
Motif
Pfam: Defensin_propep Defensin_1 MF_alpha_N Defensin_RK-1
Other DBs
NCBI-GeneID: 626682
NCBI-ProteinID: NP_001170994
MGI: 3646688
Ensembl: ENSMUSG00000074434
Vega: OTTMUSG00000019896
UniProt: D3Z1V9
Position
8; 8 A2
AA seq 94 aa
MKTLVLLSALALLAFQVQADPIQNRDEESKIDEQPGKEDQAVSVSFGDPEGSSLQEECDA
LRDRICYCRTSCKKRERLNGTCRKGHLMYKLCCR
NT seq 285 nt   +upstreamnt  +downstreamnt
atgaagacactagtcctcctctctgcccttgccctgctggccttccaagtccaggctgat
cctatccaaaacagagatgaagagagtaaaattgatgagcagccagggaaagaagaccaa
gctgtttctgtctcctttggagacccagaaggctcttctcttcaagaggaatgtgacgcg
ttgagagatcggatatgctattgtagaacaagctgcaaaaaaagagaacgcctgaatggg
acctgcagaaagggtcatttaatgtacaagctctgctgccgctga

DBGET integrated database retrieval system