KEGG   Mus musculus (mouse): 627488Help
Entry
627488            CDS       T01002                                 

Gene name
Gm6763, EG627488, Gm21293
Definition
(RefSeq) predicted gene 6763
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 FYTT DUF1645 TFIIA FoP_duplication Septin Anoctamin DDHD Presenilin
Motif
Other DBs
NCBI-GeneID: 627488
NCBI-ProteinID: NP_001257828
MGI: 3643573
Ensembl: ENSMUSG00000097427
Vega: OTTMUSG00000042979
UniProt: J3QP73
Position
10; 10 D1
AA seq 264 aa AA seqDB search
MTTMADKMDMSLEDIIKLTKIQQRRHDRPDSRVNRGTGSKRYRPAFTHGGRNRLAPYCRP
KQLPDKWQHDLFIGGFRGQNHVDTGGKLFLSNLHFGVSDADIQLLFAEFGTLKKSAVHYD
RCGRSLGTAQVHFERKADALKAMREYNGAPLDGRPMNIQLATSQIDRQGRPAQSKNRGGM
TRNPGSGVLSGGGTKKWTLGGSQGRGRGTIRNSKLQQQQQQQKQKQQQQQQKQQQKQQQK
QQQQLSAEELDAQLDAYQEMMDTS
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgactaccatggctgacaaaatggacatgtcattggaagacatcattaagctgaccaag
atccagcaaagacgtcatgacaggcctgattcccgggtgaatcgaggcactgggtctaag
aggtataggccagctttcacccatggtggaaggaacaggctggcaccatactgcagacca
aaacaacttccagacaagtggcagcatgacctgttcattggaggcttcaggggtcaaaac
cacgtggatactggtgggaagctcttcttgtcaaatctgcacttcggagtgtcagatgct
gatattcagctactctttgctgaatttggaacgttgaagaaatctgctgtgcactatgat
cgctgtggacgaagtttagggacagcacaggtgcactttgaaaggaaagcagatgccctg
aaggctatgagagagtacaatggcgcccctttggatggccgccctatgaacatccagctt
gccacctcacagattgatagacaaggaagacctgcacaaagcaaaaataggggcggcatg
acaagaaaccctggctctggagtattaagtggtggaggcaccaagaaatggacacttgga
ggcagccagggaagagggagaggcaccatcaggaactcaaaactgcagcaacagcagcag
cagcagaagcagaagcagcagcagcagcagcagaagcagcagcagaagcagcagcagaag
cagcagcagcagctatctgcagaggagctggatgcccagctggatgcttatcaggaaatg
atggacaccagctga

DBGET integrated database retrieval system