KEGG   Mus musculus (mouse): 627576
Entry
627576            CDS       T01002                                 

Gene name
Vmn2r101, EG627576
Definition
(RefSeq) vomeronasal 2, receptor 101
  KO
K04613  vomeronasal 2 receptor
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    627576 (Vmn2r101)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Vomeronasal pheromone
    627576 (Vmn2r101)
SSDB
Motif
Pfam: 7tm_3 ANF_receptor NCD3G PAP2_C DUF3810
Other DBs
NCBI-GeneID: 627576
NCBI-ProteinID: NP_001098033
MGI: 3648468
Ensembl: ENSMUSG00000094892
Vega: OTTMUSG00000039762
UniProt: E9PZS9
Position
17; 17 A3.2
AA seq 857 aa
MLLWIFIFRLLDIPKFVSAFTYNISRCYFIITEEFHHEGDVVVGAFFPLHTFYTEKKMPH
STVPYEYLDNQIQYNFKNYQYILALQFAIEEINGNPNLLPNISLGFDFYNVRFTEKFTLD
NAFIWLTALVQRKYLPNYSCKKRNFTAALTGTSWVTSAQIGTLLQLFKFPQINFGPYDPL
LSDRDQYPSLYQMASKDTYLSLAIVSLMVHFRWSWVGLILPDDHKGNKIVSDFRDEMERK
GICLAFVKMIPGTWTSHFAKFWEHMDETNVTIVYGDVDSLEGVMRNIEQRLLTRNVWNMN
IEHHVIDRADYFMLDSFHGSLIFKHNYKENFDFTKFIQTVNPNKYPEDIYLPKLWYLFFK
CSFADINCQVLNNCQTNASFDILPRHIFDVVMNAESTSIYNGVYAVAHSLHEMTRQQLQR
QPYENGEGMLFFPWELNTFLKDIELKDKWSLDWRQTIDTEYDILNLWNLPKGLGLKMKIG
SFSANAPQGKQLSLSEHMIQWPETFSEIPQSVCSESCKPGFRKVNLEGKAICCYKCTPCG
DNEISNETDVYQCVKCPEGHYANKERKSCFQKSMTFLAYEDPLGMALASIALCLSALTFF
VIGIFVKHRDTPIVKANNRTLSYILLITLTFCFLCSLNFIGQPNRATCILQQTTFAVTFT
VALATVLAKAITVVLAFKVSFPGKIVRWLMLSRGPNYIIPICTLIQLLLCGIWMTTSPPF
IDLDAHTEYGHIIILCNKGSAVAFHSVLGYLCFLALGSYTMAFLSRNLPDTFNESKFLSF
SMLVFFCVWLTFLPVFHSTKGKIMVAMEVFSILASTTALLAFIFGPKCYIILLRPEENSF
THIQKKTHSRRKNFPKI
NT seq 2574 nt   +upstreamnt  +downstreamnt
atgctcctctggatttttatcttcaggcttttggatattcccaaatttgtctctgctttt
acctataatatcagtagatgttatttcataatcactgaagaatttcaccatgaaggagat
gttgtggttggtgcatttttccctcttcatactttctacacggaaaagaaaatgccacat
tcaactgtaccatatgaatatttggacaatcaaatacagtataactttaagaactaccag
tatattcttgctctgcaatttgcaattgaggagatcaatgggaaccccaatctgctaccc
aacatatctcttggttttgatttttacaatgtcagattcactgagaagttcactcttgat
aatgcttttatttggctcacagctcttgtgcaaagaaagtatttacctaattatagttgt
aaaaagagaaatttcactgcagcactcacaggaacatcatgggtaacatctgcccagata
gggacattgcttcaactctttaaatttccacagattaattttggaccttatgatccttta
ttaagtgaccgtgatcagtatccttctctctaccagatggcctccaaggacacatatctt
tcacttgccattgtttcattaatggttcatttcaggtggtcatgggttggtctcatactc
cctgatgaccacaaaggaaataagattgtatcagattttagggacgagatggagagaaaa
ggcatctgcctagcttttgtaaaaatgatcccaggcacatggacttcacattttgccaaa
ttctgggaacatatggatgagacaaatgtaacaattgtttatggtgatgttgattcgcta
gaaggtgtaatgaggaatattgaacaaaggttattgacacggaatgtctggaacatgaac
attgaacaccatgttattgacagagctgactatttcatgttagactcattccatggaagc
ctaatttttaagcacaattacaaagagaattttgattttaccaaatttattcaaacagtt
aatcctaataaatacccagaagacatttatcttcctaagctgtggtatttatttttcaag
tgctcatttgctgacattaattgtcaagttttgaacaactgtcaaaccaatgcttctttc
gatatattacctcgacacatatttgatgtggtcatgaatgcagagagcacaagtatttac
aatggtgtgtatgctgtggctcacagcctccatgagatgacacgtcagcaacttcaaagg
caaccatatgaaaatggagaagggatgttgttctttccatgggagcttaacactttcctg
aaagacattgaactgaaagacaaatggagtttagattggagacagacaatagatacagag
tatgacattcttaacctttggaatttaccaaagggccttggattaaaaatgaaaatagga
tccttttctgcaaatgctcctcagggtaaacagttgtcgttatctgaacacatgatacaa
tggccagaaacattttcagagatcccccagtctgtatgcagtgagagttgtaagcctgga
ttcaggaaagtaaacctagagggcaaggccatctgctgctacaagtgcactccttgtgga
gacaatgagatttctaatgagacagatgtttaccagtgtgtgaagtgtccagaaggtcat
tatgcaaataaagagaggaaatcctgcttccaaaaatctatgacgttccttgcctatgaa
gaccctttggggatggctctagccagcatagctttgtgcttatctgcactcacattcttt
gttattggcatctttgtgaaacacagagatacccctattgtaaaggcaaataatcgaact
ctcagttacattttgctcatcacactcaccttctgtttcttatgttctttgaacttcatt
ggtcagccaaacagagctacctgcatccttcagcagactacctttgcagttactttcact
gtggctcttgctactgtgttggccaaagctattactgtggtccttgcctttaaggtcagt
tttccagggaaaatagtaaggtggctaatgttatcaagaggtccaaactacatcattcct
atatgtaccctgatccaacttcttctttgtggaatatggatgacaacttctccaccgttc
attgacctagatgctcatactgaatatggacacatcatcattttgtgcaataagggctca
gctgttgccttccactctgtcctgggatacctctgtttcttggcccttgggagttatacc
atggccttcttgtctagaaatttgcctgatacattcaacgaatccaaatttctgtcattc
agtatgctggtgttcttctgtgtctggctcacttttcttcctgtcttccacagcactaaa
gggaagatcatggttgctatggaagtattttcaatcttggcttccaccacagcactcctt
gccttcatatttggacccaagtgttacattatcttgttgagaccagaggagaattcattt
actcatattcagaagaaaacacactctagaaggaagaattttcctaaaatatag

DBGET integrated database retrieval system