KEGG   Mus musculus (mouse): 627805
Entry
627805            CDS       T01002                                 

Gene name
Vmn2r108, EG627805
Definition
(RefSeq) vomeronasal 2, receptor 108
  KO
K04613  vomeronasal 2 receptor
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    627805 (Vmn2r108)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Vomeronasal pheromone
    627805 (Vmn2r108)
SSDB
Motif
Pfam: 7tm_3 ANF_receptor NCD3G
Other DBs
NCBI-GeneID: 627805
NCBI-ProteinID: NP_001098040
MGI: 3643822
Ensembl: ENSMUSG00000091805
Vega: OTTMUSG00000039781
UniProt: E9PYS0
Position
17; 17 A3.2
AA seq 855 aa
MFSCIFISSLLLIAKFVLTFMHVNISKCFYKITEDFHHEGDVVIGAFFPLHTYYTKNKIP
HSYLPYYYKDNYLQYNFKNYQYILALVFAIEEINDNPNLLPNISLGFDFYNVRFIEKDTL
MNVCFWLTGQGQKNILPNYNCGKSNFATALTGTAWTTSAQIGTLLQLFKFPQLSFGPYDS
ILSDRGQYSSLYQMASKYTSISLGIVSLMVHFRWSWVGLILPDNHKGNKILSEFREDMER
KGVCIAFVKMIPMTWNAYYNKFWENMDETNVIIIYGDIDSLTGLMRNIGQRLLTAKVWIM
NTEPHITDYADYFMLDSFHGSLIFTHNYRKSFKISNFIQTVNPYKYPEDIYLPKLWHLFF
KCSFSDVDCRLLANCQPNASLDVLPSHILDMVISEESNNIYNAVYAVAHSLHQMHLQEVQ
IKPHENGEAIAFFPWQLNIFLKDINERDNMSFGGRQKLNAEYDILNLWNLPKGLGQKVKI
GSFSANAPEGQQLSLSEQMIQWAEGFSEIPQSVCSESCGPGFRKVTLEGKAICCYNCTPC
ADNEISNETDVDQCVKCPESHYSNTEKNHCLQKTVIFLAYEDPLGMTLACIALCLSALTA
FVIGVFVKYRDTPIVKANNRGLSYTLLITITFCLLCSLNFIGQPNTASCILQQNIFGVAF
TVALATVLAKAITVVLAFKATFPGRMVRWLMTSRAPNYIIPLCTLIQLFICGIWMTMSPP
FIHQDNHAEHGHILLLCNKGSSVAFHCVLGYLCSLAFGGYTMAFLSRNLPDTFNESKFLS
FSMVVFFCVWVTFLPVYHSTKGKVMVAVEVFSILASSTALLGFIFAPKCYIILFRPEKNS
FHRIKDKTYSRWNKI
NT seq 2568 nt   +upstreamnt  +downstreamnt
atgttctcttgtatttttatctcctcactacttctgattgccaaatttgtccttaccttt
atgcatgttaatatcagtaaatgtttttacaaaattactgaggattttcatcatgaagga
gatgtggtgattggtgcatttttccctcttcatacgtactatacgaagaataaaattcca
cattcttatctaccatattattataaggacaattacctccaatataattttaagaactac
cagtatattctggctttggtgtttgctattgaggagatcaatgataatcccaatctttta
cctaatatatctcttggatttgatttctacaatgtcagattcattgagaaggacactctt
atgaatgtctgtttttggctcactggtcaagggcagaaaaatattttaccaaattacaat
tgcggcaaaagtaattttgctactgctctcacaggaacagcatggacaacgtctgcccaa
attggtacattgcttcaactctttaaatttcctcagctttcttttggaccttatgattcc
atcttgagtgaccgtggacaatattcttctctctatcagatggcctccaagtacacatct
atttcacttggcattgtatctttgatggttcattttaggtggtcttgggttggtctcatc
cttccagataaccacaaaggaaataaaattttatcagagttcagagaagatatggagaga
aaaggagtctgcatagcttttgtgaaaatgatccctatgacatggaatgcatattataac
aaattctgggaaaatatggatgagacaaatgttataattatttatggtgacattgattct
ctcacaggtctaatgcgaaatattgggcaaagattgttgacagcaaaagtctggatcatg
aacactgaacctcatattactgactatgctgactatttcatgcttgactcattccatggt
agcttaatttttacacacaattatagaaagagttttaagatttctaattttattcaaaca
gttaatccttacaaataccctgaagacatttaccttcctaagttatggcatttgttcttc
aaatgctcattttctgatgttgattgtcgacttttggctaactgtcaacccaatgcttct
ctggatgtgttacctagtcatatattggacatggtaattagtgaagaaagcaataatatc
tataatgctgtgtatgctgtggctcacagtctccatcagatgcatcttcaagaagtacaa
ataaaaccacatgaaaatggggaagcaatagccttcttcccctggcagcttaacattttc
ctgaaggacatcaatgagagagacaatatgagtttcggtgggagacagaaattaaatgca
gaatatgacattcttaacctttggaatttaccaaagggtcttggacaaaaggtgaaaata
ggatccttttcagcaaatgctcctgagggccaacagttgtctttatctgaacagatgata
caatgggcagaaggattctcagagatccctcaatctgtgtgcagtgagagttgtgggcct
ggattcagaaaagtaaccctggagggcaaggccatctgctgctacaattgcactccctgt
gcagataatgagatttctaatgagacagatgtggatcaatgtgtcaagtgtccagagagt
cattattcaaatacagagaagaaccactgtttacagaaaactgtgatctttctggcctat
gaagaccccttggggatgacactggcctgtatagctttgtgtttatctgcactcacagcc
tttgtaattggggtctttgtgaaatacagagacactcccattgtgaaagccaataataga
ggtctcagttacactttgctcatcacaatcaccttctgtttactctgttctttgaacttc
attggtcaacccaatacagcctcctgcatccttcagcagaacatatttggagttgcattc
actgtggctctagctaccgtgttggccaaagctattactgtggtccttgccttcaaggcc
acttttccagggagaatggtgaggtggttaatgacatcaagagctccaaactatataatt
cctctttgtacgctgatccaactttttatttgtggaatatggatgacaatgtcgcctcca
ttcattcaccaagacaatcatgctgaacatggacacatcttacttttgtgtaacaaggga
tcatctgttgctttccactgtgttctgggatacctatgctccttggcttttgggggatac
accatggcattcttatctagaaatctgcctgatacattcaatgaatccaaatttctctca
ttcagcatggtggtgttcttctgtgtatgggtcacctttcttcctgtctaccatagcact
aaagggaaggtcatggtggctgtggaagtcttctctatcttggcttccagtacagccctc
cttggcttcatatttgcccctaagtgttacattatcttatttagaccagagaagaattca
tttcatcgtatcaaggacaaaacatattctagatggaataaaatatag

DBGET integrated database retrieval system