KEGG   Mus musculus (mouse): 631304Help
Entry
631304            CDS       T01002                                 

Gene name
Cyp4f40, EG631304
Definition
(RefSeq) cytochrome P450, family 4, subfamily f, polypeptide 40
  KO
K00490  cytochrome P450 family 4 subfamily F [EC:1.14.14.1]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:mmu00199]
    631304 (Cyp4f40)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     631304 (Cyp4f40)
Cytochrome P450 [BR:mmu00199]
 Cytochrome P450, animal type
  CYP4 family
   631304 (Cyp4f40)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450 TetR_C_28
Motif
Other DBs
NCBI-GeneID: 631304
NCBI-ProteinID: NP_001095058
MGI: 3645508
Ensembl: ENSMUSG00000090700
UniProt: G3UW81
Position
17; 17 B1
AA seq 524 aa AA seqDB search
MRYLDLSWLGLGPMSASPWLLFFLVGISWFLARFLTQLYTLYAKCQRLCGFPQPPKKNWF
WGHLGMSPPTEEGMKQVTELVTTYPQGFMTWLGPIVPLITLCHPDIIRSVLSASAAVAPK
DDIFYSFLKPWLGDGLLVSAGDKWNRHRRMLTPAFHFNILKPYVKIFNDSTNIMHAKWLR
LASGGSTRLNMFENISLMTLDTLQKCVFSFNSNCQEKPSQYIAAILELSTLAVKRNEQLL
MHVDLLYRLTPDGMRFYKACRLVHDFTDAVIQERRRTLLKHGGDDIIKAKAKSKTLDFID
VLLLTKDEDGKELSDEDIRAEADTFMFRGHDTTASGLSWILYNLARHPEHQERCRQEVQE
LLRDRDPKEIEWDDLAQLPFLTMCIKESLRLHPPVTMVSRCCTQDISLPDGRIIPKGVIC
IINIFGTHHNPTVWRDPEVYDPFRFDPENIQARSPLSFIPFSAGPRNCIGQTFAMSEMKV
ALALTLLRFRILPDDKEPRRKPELILRAEGGLWLRVEPLSTQAQ
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgcgatatctggacttatcctggctaggactggggcccatgtcagcctcaccgtggcta
ctctttttcttggttgggatttcctggttcttggcccggttcctcacgcagctatacact
ttgtatgcaaagtgtcaacgtctctgtggtttccctcagccacccaagaagaattggttt
tggggtcacctgggcatgtcccctcctacagaagaaggcatgaagcaggtgactgagctg
gtgaccacctatccccagggcttcatgacctggttaggccctatagttcctctcatcact
ctgtgccaccctgatatcatccgatctgtcctcagcgcctcagctgcggttgccccaaag
gacgacatcttctacagcttcttgaaaccctggctcggggatgggctcttggtgagtgct
ggtgacaagtggaaccgccaccgacgcatgctgacacctgccttccatttcaacatcctg
aaaccctatgtgaagattttcaatgacagcaccaacatcatgcatgccaagtggctgcgc
ctggcctcagggggtagcacccgtctgaacatgtttgagaacatcagcctcatgaccttg
gacactttgcagaaatgcgtcttcagcttcaacagcaactgtcaggagaagcctagccag
tatattgctgccatcttggagctcagtaccctggctgtgaagagaaacgagcaactgctt
atgcatgtggacctgctctaccgcctcacgcccgatggaatgcgcttctataaggcctgc
cgtctggtacacgacttcaccgatgccgtcatccaggagcgacgtcgcactctgctgaag
catggtggtgatgatatcatcaaggccaaagccaagtccaagactttggacttcattgat
gtactgctgctaaccaaggatgaagatggaaaggagctgtcagatgaggacatccgagct
gaagctgacaccttcatgtttaggggccatgacaccacagccagtgggctctcctggatc
ctgtacaacttggcgaggcaccctgagcaccaggagcgctgccggcaggaggtgcaggag
ctgctgagggatcgtgatcccaaggagatcgaatgggacgacctggcccagctgcccttc
ctgaccatgtgcatcaaggagagtctgcggctgcatcccccagtcacaatggtctcccga
tgctgcacccaggacatttccctcccagatggaaggatcatccctaaaggtgtcatctgc
atcatcaatatttttggaacccatcacaacccaactgtgtggcgggaccctgaggtctat
gaccccttccgttttgatccagagaacatccaggctagatcacctctgtcatttattccc
ttctcagcggggccaaggaactgcattggacagactttcgctatgagcgagatgaaggtg
gcgctggcgctgactctgctgcgcttccgcatcctgccagatgacaaggagccacgccgg
aagccagagctgatcctgcgcgcagagggcgggctgtggctgcgggtggagccgctgagc
acccaagcacaataa

DBGET integrated database retrieval system