KEGG   Mus musculus (mouse): 631323
Entry
631323            CDS       T01002                                 

Gene name
Gm12250, Irgb10
Definition
(RefSeq) predicted gene 12250
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: IIGP MMR_HSR1 Dynamin_N RsgA_GTPase ABC_tran FtsK_SpoIIIE FeoB_N AIG1 AAA_29 Zeta_toxin Roc T2SSE KAP_NTPase AAA_16 AAA_22 Septin Sigma54_activat Trp_halogenase GTP_EFTU TsaE RNA_helicase Sigma54_activ_2 DOT1 PRK AAA_23
Other DBs
NCBI-GeneID: 631323
NCBI-ProteinID: NP_001128587
MGI: 3649299
UniProt: Q0GUM3
Position
11; 11 B1.3
AA seq 417 aa
MGQSSSKPDAKAHNMASSLTEFFKNFKMESKIISKETIDSIQSCIQEGDIQKVISIINAA
LTDIEKAPLNIAVTGETGAGKSTFINALRGIGHEESESAESGAVETTKDRKKYTHPKFPN
VTIWDLPGVGTTNFKPEEYLKKMKFQEYDFFLIISSARFRDNEAQLAEAIKKMKKKFYFV
RTKIDSDLWNEKKAKPSSYNREKILEVIRSDCVKNLQNANAASTRVFLVSSFEVAQFDFP
SLESTLLEELPAHKRHIFVQCLPTITEPAIDRRRDVLKQTIWLEALKAGASATIPMMSFF
NDDIEEFEKILSHYRACFGLDDESLENMAKEWSMSVEELESTIKSPHLLSSEPNESVADK
LVKTMEKIFAVTGGFVATGLYFRKSYYMQNYFLDTVTEDAKVLLKKKVFLQDSVDSE
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgggtcagtcttcttctaaacccgatgcaaaggctcacaatatggcctccagccttact
gaattcttcaagaatttcaagatggaaagcaaaatcatttctaaggagaccatcgattca
attcagtcatgtatccaagaaggagacatccagaaggtgatttctataatcaatgctgcc
ttgacagacattgagaaagcccccctgaacatcgctgtgacaggggagacaggggcaggg
aagtccacgttcattaatgcccttcggggaataggacatgaggaaagtgagtcagctgag
agtggagcggtggagacaaccaaggacaggaagaaatacacccaccctaagttccctaat
gtgaccatctgggatctccctggggttgggacaactaacttcaaaccagaagaatatctg
aagaaaatgaagttccaggagtatgattttttcctgatcatctcatctgctcgctttaga
gataatgaagcccagctggctgaagcaatcaaaaaaatgaaaaagaagttctactttgtt
cggaccaaaattgacagtgatttgtggaatgagaagaaagctaaacccagttcctacaat
agggagaaaatcctggaggtgatccgaagtgactgtgtaaagaatctgcagaatgctaac
gcagcctctactcgtgtcttcttagtctcaagctttgaggtagcacagtttgattttcct
agcctggagtccacccttttggaagagctgccagcacacaagcgccacatcttcgtgcag
tgcctccctaccattactgagcctgctattgatcgcaggagagatgtcctgaaacagaca
atctggctggaggctctgaaggctggagcgtcggccaccatccccatgatgtcattcttc
aatgacgacattgaggaatttgagaagatcctgagccactacagggcttgctttgggcta
gatgatgagtcgctggaaaacatggccaaggagtggtccatgtctgtggaggagctggag
tccaccattaagtcaccccatttgctgtcaagtgagccgaatgaatctgtggcggacaag
ctggtgaaaaccatggagaaaatttttgccgtcactggcggattcgtagccactggcctt
tactttagaaagagttactatatgcaaaattattttcttgacacagtgacagaggatgct
aaagttctacttaagaaaaaagtctttttgcaggacagtgtggactctgagtaa

DBGET integrated database retrieval system