KEGG   Mus musculus (mouse): 631624
Entry
631624            CDS       T01002                                 

Gene name
Gm7072, EG631624
Definition
(RefSeq) predicted gene 7072
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_11 KRAB zf-C2H2_6 zf-H2C2_5 C1_4 C1_1 zf-C2H2_jaz Ntox34
Other DBs
NCBI-GeneID: 631624
NCBI-ProteinID: NP_001344920
MGI: 3648314
Ensembl: ENSMUSG00000117284
Position
17; 17 A3.3
AA seq 689 aa
MNASLLNAPQGQLTFKDVAVDFSQEEWECLDCAQRALYMDVMLENYNNLLFVENQYMCPE
FENMLNQDLQHIVHEHANTQVKSYECHELDKIIHESTGSAPSKTNLRATSVESSNLSRHE
TENNREPCKDKNHVNCFNLCSTISLNQGINIGKKEYNGAKLDKVFDSKETLILKQTKSVK
KPYKCSECEKCFIQVGDLRKHQRIHKGEKPYKCNECEKCFSYKSSLRTHQRIHTGENPYK
CSECDKCFSHKGSLSIHQMYHTGKKPYKCSECEKCFIQVGDLRRHERIHTGEKPYKCNEC
EKCFSSKTNLRTHQRIHTGEKPYKCSECDKGFTLKCSLIIHQVYHTGKKPYKCSECEKCF
IQVGDLRKHQRIHTGEKPYKCSECDKSFTQKGSLSIHQRIHAGEKPYRCSECDKGFTLKC
SLIIHQIIHTGEKTYKCSECDKCFSHKGSLKVHLRIHTGENLYKCSECDKCFTKKWRLTS
HQTIHTGEKPYKCSECDKSFTLKGNLRDHQRIHTGEKPYKCSECDKYYTRKSHLIVHQKI
HAGEKPYKCSECDKYYTRKSHLIVHQRIHIGEKPYKCSECNKCFTNKYHLRTHQRIHSAN
KPYKCSECDKCFTEKYRLIIHQRIHTGEKPYKCSECDKYFTRKSSLNVHQRVHTGEKPYK
CSECDKCFSLKGDLRKHQRIHTGERTLQM
NT seq 2070 nt   +upstreamnt  +downstreamnt
atgaacgcctctctcctaaatgctcctcagggtcagttaacattcaaggatgtggctgtt
gacttctcacaggaggaatgggaatgtcttgactgtgctcagagggcattgtacatggat
gtgatgttggagaattacaataatctgctttttgtggagaatcaatacatgtgtcctgaa
tttgagaacatgttgaatcaagatctacagcatattgtccacgaacatgcaaatacccaa
gtgaaatcttatgaatgtcatgagcttgacaaaatcatccatgagtccacaggaagtgca
ccttctaaaactaacctcagggctacatctgttgaatcatcaaacctaagcagacatgaa
actgaaaacaacagagaaccttgcaaagataaaaaccatgtaaactgtttcaatttgtgc
tctaccattagtctaaatcaaggaatcaacataggaaagaaagaatacaatggtgcaaag
cttgataaggtttttgactctaaagaaaccctcatattgaaacaaaccaaaagtgtaaag
aaaccttacaaatgtagtgaatgtgagaaatgcttcattcaagttggtgatcttagaaaa
catcagagaattcataaaggagagaaaccttacaaatgtaatgaatgtgaaaaatgcttt
agctacaaaagcagccttagaactcatcagagaattcatacaggagagaatccttacaaa
tgtagtgaatgtgacaaatgcttttcccacaaaggcagtcttagtattcatcagatgtat
catacaggcaagaaaccttacaaatgtagtgaatgtgagaaatgcttcattcaagttggt
gatcttagaagacatgagagaattcatacaggagagaaaccttacaaatgtaatgaatgt
gaaaaatgctttagctccaaaaccaaccttagaactcatcagagaattcatacaggagag
aagccgtacaaatgtagtgaatgtgacaaaggctttactctaaaatgcagtcttatcatt
catcaagtgtatcatacaggcaagaaaccttacaaatgtagtgaatgtgagaaatgcttc
attcaagttggtgaccttagaaaacatcagagaattcatacaggagagaaaccttacaaa
tgtagtgaatgtgacaaaagctttacccaaaaaggcagtcttagtattcatcagagaatt
catgcaggagagaaaccttacagatgtagtgaatgtgacaaaggctttactctaaaatgc
agtcttatcattcatcaaataattcatacaggagagaaaacttacaaatgtagtgaatgt
gacaaatgcttttcccacaaaggcagtcttaaagttcatctgagaattcatacaggagaa
aatctttacaaatgtagtgagtgtgacaaatgctttacaaagaaatggcgtcttacaagt
catcagacaattcatacaggagagaaaccttacaaatgcagtgaatgtgacaaatctttt
accctgaaaggcaatcttagagatcatcaacgaattcatacaggagagaaaccttacaaa
tgtagtgaatgtgacaaatactacactcgaaaaagccatcttattgttcatcagaaaatt
catgctggagaaaaaccctacaaatgtagtgaatgtgacaaatactacactcgaaaaagc
catcttattgttcatcagcgcattcacataggagaaaaaccttacaaatgcagtgaatgt
aacaaatgctttaccaacaaatatcatcttagaactcatcagagaatacattcagctaat
aaaccttacaaatgtagtgaatgtgacaaatgctttactgaaaaatacagacttattatt
catcagagaattcatacaggagagaaaccttacaaatgtagtgaatgtgacaagtacttt
acccgaaaaagcagtcttaatgtgcaccagagagttcatacaggagagaaaccttacaaa
tgtagtgaatgtgacaaatgcttttctcttaaaggtgatcttagaaaacatcagagaatt
catacaggagaaagaaccttacagatgtga

DBGET integrated database retrieval system