KEGG   Mus musculus (mouse): 634825
Entry
634825            CDS       T01002                                 

Symbol
Defa38, CRS1C-2, Gm14851
Name
(RefSeq) defensin, alpha, 38
  KO
K05230  defensin, alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
mmu05150  Staphylococcus aureus infection
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    634825 (Defa38)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    634825 (Defa38)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    634825 (Defa38)
SSDB
Motif
Pfam: Defensin_propep MF_alpha_N DUF3316
Other DBs
NCBI-GeneID: 634825
NCBI-ProteinID: NP_001170953
MGI: 3709605
Ensembl: ENSMUSG00000061958
Vega: OTTMUSG00000018260
UniProt: Q5ERJ0
Position
8 A2; 8
AA seq 116 aa
MKTLVLLSALALLAFQVQADPIQNTDEETKTEEQPEEEDQAVSVSFGGTEGSALQDVAQR
RFLWCRKCPVCQKCQVCQKCPVCPTCPQCPKQPLCEERQNKTAITTQAPNTQHKGC
NT seq 351 nt   +upstreamnt  +downstreamnt
atgaagacacttgtcctcctctctgcccttgccctgctggccttccaggtccaggctgat
cctatccaaaacacagatgaagagactaaaactgaggagcagccagaggaagaggaccag
gctgtttctgtctcctttggaggcacagaaggctctgctcttcaagatgtagcccaacga
aggtttctgtggtgccggaagtgcccagtgtgccagaagtgccaagtgtgccagaagtgc
cctgtgtgccccacatgccctcagtgcccaaagcagccattgtgcgaagaaaggcaaaat
aaaactgcaatcaccacccaagctccaaatacacagcataaaggctgttga

DBGET integrated database retrieval system