KEGG   Mus musculus (mouse): 637578
Entry
637578            CDS       T01002                                 

Gene name
Gm20765
Definition
(RefSeq) predicted gene, 20765
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: RRM_1 TFIIA Anoctamin Septin FoP_duplication Peptidase_S49_N Presenilin
Other DBs
NCBI-GeneID: 637578
NCBI-ProteinID: NP_001257573
MGI: 5434121
Ensembl: ENSMUSG00000095022
Vega: OTTMUSG00000042983
UniProt: J3QP73
Position
10; 10 D1
AA seq 264 aa
MTTMADKMDMSLEDIIKLTKIQQRRHDRPDSRVNRGTGSKRYRPAFTHGGRNRLAPYCRP
KQLPDKWQHDLFIGGFRGQNHVDTGGKLFLSNLHFGVSDADIQLLFAEFGTLKKSAVHYD
RCGRSLGTAQVHFERKADALKAMREYNGAPLDGRPMNIQLATSQIDRQGRPAQSKNRGGM
TRNPGSGVLSGGGTKKWTLGGSQGRGRGTIRNSKLQQQQQQQKQKQQQQQQKQQQKQQQK
QQQQLSAEELDAQLDAYQEMMDTS
NT seq 795 nt   +upstreamnt  +downstreamnt
atgactaccatggctgacaaaatggacatgtcattggaagacatcattaagctgaccaag
atccagcaaagacgtcatgacaggcctgattcccgggtgaatcgaggcactgggtctaag
aggtataggccagctttcacccatggtggaaggaacaggctggcaccatactgcagacca
aaacaacttccagacaagtggcagcatgacctgttcattggaggcttcaggggtcaaaac
cacgtggatactggtgggaagctcttcttgtcaaatctgcacttcggagtgtcagatgct
gatattcagctactctttgctgaatttggaacgttgaagaaatctgctgtgcactatgat
cgctgtggacgaagtttagggacagcacaggtgcactttgaaaggaaagcagatgccctg
aaggctatgagagagtacaatggcgcccctttggatggccgccctatgaacatccagctt
gccacctcacagattgatagacaaggaagacctgcacaaagcaaaaataggggcggcatg
acaagaaaccctggctctggagtattaagtggtggaggcaccaagaaatggacacttgga
ggcagccagggaagagggagaggcaccatcaggaactcaaaactgcagcaacagcagcag
cagcagaagcagaagcagcagcagcagcagcagaagcagcagcagaagcagcagcagaag
cagcagcagcagctatctgcagaggagctggatgcccagctggatgcttatcaggaaatg
atggacaccagctga

DBGET integrated database retrieval system