KEGG   Mus musculus (mouse): 63828
Entry
63828             CDS       T01002                                 

Symbol
Fn3k, 2310074G21Rik
Name
(RefSeq) fructosamine 3 kinase
  KO
K15522  protein-fructosamine 3-kinase [EC:2.7.1.171]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    63828 (Fn3k)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.171  protein-fructosamine 3-kinase
     63828 (Fn3k)
SSDB
Motif
Pfam: Fructosamin_kin APH RIO1 APH_6_hur
Other DBs
NCBI-GeneID: 63828
NCBI-ProteinID: NP_071297
MGI: 1926834
Ensembl: ENSMUSG00000025175
Vega: OTTMUSG00000004677
UniProt: Q9ER35
Position
11; 11 E2
AA seq 309 aa
MEQLLRAQLHTTTLRAFGSSGGGCISEGYAYYTDSGPVFVKVNRRTQARQMFEGEMASLE
ALRNTGLVRVPKPMKVIDLPGGGAVFVMEHLKMKSLSSQASKLGEQMADLHLYNQKLREK
SKTRQNTVGCGAEGAEPQGVTKFGFHTVTCCGFIPQVNEWQEDWPTFFTRHRLQAQLDLI
EKDYADRETQELWSRLQVKIPDLFAGIEIVPALLHGDLWSGNVAEDDQGPVIYDPASFYG
HSEFELAIASMFGGFPRSFFTAYHRKIPKAPGFDKRLLLYQLFNYLNHWNHFGREYRSPS
LGVMRKLLR
NT seq 930 nt   +upstreamnt  +downstreamnt
atggagcagctgctgcgcgcccagcttcacaccacaacactgcgggcctttgggagctcc
ggagggggctgcatcagcgagggctatgcctactacactgacagtggccccgtgtttgtc
aaggtcaatcgcaggacacaggcccggcagatgtttgagggagagatggcgagcctggag
gccctccgcaacactggcttggtgcgggttcctaagcccatgaaggtgattgacttgcca
ggaggtggggctgtctttgtgatggagcacttgaagatgaagagccttagcagtcaggca
tcaaagctcggggaacagatggcagacctgcacctttacaatcagaagctcagggagaag
tccaagactcggcagaacacagtgggctgtggggcggagggtgctgagccccagggtgtg
accaagtttggctttcacacagtgacatgctgtggctttatcccacaggtgaatgaatgg
caggaggactggccgaccttcttcactcgacaccggctccaagctcagttggatctcatt
gaaaaggactatgctgaccgagagacacaagagctgtggtcaaggctacaggtgaagatc
ccggatctgtttgcgggtatagagattgtccctgccctgctccatggagacctctggtct
ggaaatgtggctgaggatgaccagggacccgtaatttatgatccagcctccttctatggc
cattctgagtttgaactggccattgcatcgatgtttggggggttccccagatccttcttc
actgcctaccatcggaagatcccaaaggctccagggttcgacaagcgcctgctgctgtac
cagctctttaactacctaaaccactggaaccactttggacgggagtacagaagcccgtcc
ctgggggtgatgaggaagctgctcaggtag

DBGET integrated database retrieval system