KEGG   Mus musculus (mouse): 63856Help
Entry
63856             CDS       T01002                                 

Gene name
Taf8, AW260255, Tbn
Definition
(RefSeq) TATA-box binding protein associated factor 8
  KO
K14649  transcription initiation factor TFIID subunit 8
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    63856 (Taf8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    63856 (Taf8)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     63856 (Taf8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Bromo_TP TAF8_C TFIID-31kDa Bromo_TP_like DUF3090 CENP-S
Motif
Other DBs
NCBI-GeneID: 63856
NCBI-ProteinID: NP_071298
MGI: 1926879
Ensembl: ENSMUSG00000023980
UniProt: Q9EQH4
Position
17; 17 C
AA seq 308 aa AA seqDB search
MADTAAGPGGSGTRPGSKQSTNPADNYHLARRRTLQVVVSSLLTEAGFESAEKASVETLT
EMLQSYISEIGRSAKSYCEHTARTQPTLSDIVVTLVEMGFNVDTLPAYAKRSQRMVITAP
PVTNQPVTPKALTAGQNRPHPPHIPSHFPEFPDPHTYIKTPTYREPVSDYQILREKAASQ
RRDVERALTRFMAKTGETQSLFKDDVSTFPLIAARPFTIPYLTALLPSELEIQQMEETDS
SEQEEQTDTENNALHISTDDSGAEKESASVLQQSSSLSGSRNGEESVIDNPYLRPVKKPK
IRRKKSLS
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggctgacacggcggccgggcctggtggctccggaacgagaccgggaagtaagcaatcc
actaaccctgctgataactaccatctggcccggaggaggaccctgcaagtggttgtgagc
tccttgctgacagaggcgggatttgagagtgccgagaaagcgtctgtggagacactgaca
gagatgctgcagagctacatctcagaaatcgggagaagtgctaagtcatactgtgagcac
acagccaggacccagcccacactgtcggacatcgtggtcacattggttgaaatgggcttc
aatgttgacactctacctgcctatgcaaaacggtctcagaggatggtcatcactgcacct
ccagtgaccaatcagccagtgacccccaaggccctcactgcagggcagaaccggccccac
ccgccacacatccccagccattttcctgagtttccggatccccacacctacatcaaaact
ccgacataccgtgagccagtgtctgactaccagatccttcgggagaaggccgcatctcag
agacgagacgtggagcgagcactcacccgcttcatggccaagacaggcgagacccagagt
cttttcaaggatgatgtcagcacttttcctttgatcgctgccagaccgttcaccatcccc
tacctcacggccttgcttccttctgagctggagatacagcagatggaagagaccgactcc
tcggagcaggaggagcaaacagatacagagaacaacgctcttcatatcagcacggacgat
tccggagctgagaaggagagcgcttctgttctgcagcagagctcctccttgtccggcagc
cggaatggcgaggagagcgtcatcgataacccctatctgcggcccgtgaagaagcccaag
atccgtaggaagaagtccctctcgtga

DBGET integrated database retrieval system