KEGG   Mus musculus (house mouse): 63873
Entry
63873             CDS       T01002                                 
Symbol
Trpv4, 0610033B08Rik, OTRPC4, Trp12, VR-OAC, VRL-2, VROAC
Name
(RefSeq) transient receptor potential cation channel, subfamily V, member 4
  KO
K04973  transient receptor potential cation channel subfamily V member 4
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04218  Cellular senescence
mmu04750  Inflammatory mediator regulation of TRP channels
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    63873 (Trpv4)
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    63873 (Trpv4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    63873 (Trpv4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    63873 (Trpv4)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   63873 (Trpv4)
SSDB
Motif
Pfam: Ion_trans Ank_2 Ank_3 Ank Ank_4 Ank_5
Other DBs
NCBI-GeneID: 63873
NCBI-ProteinID: NP_071300
MGI: 1926945
Ensembl: ENSMUSG00000014158
UniProt: Q9EPK8
Position
5:complement(114760213..114796497)
AA seq 871 aa
MADPGDGPRAAPGEVAEPPGDESGTSGGEAFPLSSLANLFEGEEGSSSLSPVDASRPAGP
GDGRPNLRMKFQGAFRKGVPNPIDLLESTLYESSVVPGPKKAPMDSLFDYGTYRHHPSDN
KRWRRKVVEKQPQSPKAPAPQPPPILKVFNRPILFDIVSRGSTADLDGLLSFLLTHKKRL
TDEEFREPSTGKTCLPKALLNLSNGRNDTIPVLLDIAERTGNMREFINSPFRDIYYRGQT
SLHIAIERRCKHYVELLVAQGADVHAQARGRFFQPKDEGGYFYFGELPLSLAACTNQPHI
VNYLTENPHKKADMRRQDSRGNTVLHALVAIADNTRENTKFVTKMYDLLLLKCSRLFPDS
NLETVLNNDGLSPLMMAAKTGKIGVFQHIIRREVTDEDTRHLSRKFKDWAYGPVYSSLYD
LSSLDTCGEEVSVLEILVYNSKIENRHEMLAVEPINELLRDKWRKFGAVSFYINVVSYLC
AMVIFTLTAYYQPLEGTPPYPYRTTVDYLRLAGEVITLFTGVLFFFTSIKDLFTKKCPGV
NSLFVDGSFQLLYFIYSVLVVVSAALYLAGIEAYLAVMVFALVLGWMNALYFTRGLKLTG
TYSIMIQKILFKDLFRFLLVYLLFMIGYASALVTLLNPCTNMKVCDEDQSNCTVPTYPAC
RDSETFSAFLLDLFKLTIGMGDLEMLSSAKYPVVFILLLVTYIILTFVLLLNMLIALMGE
TVGQVSKESKHIWKLQWATTILDIERSFPVFLRKAFRSGEMVTVGKSSDGTPDRRWCFRV
DEVNWSHWNQNLGIINEDPGKSEIYQYYGFSHTVGRLRRDRWSSVVPRVVELNKNSSADE
VVVPLDNLGNPNCDGHQQGYAPKWRTDDAPL
NT seq 2616 nt   +upstreamnt  +downstreamnt
atggcagatcctggtgatggtccccgtgcagcgcctggggaggtggctgagccccctgga
gatgagagtggtacctctggtggggaggccttccccctctcttccctggccaatctgttt
gagggggaggaaggctcctcttctctttccccggtggatgctagccgccctgctggccct
ggcgatggacgtccaaacctgcgtatgaagttccagggcgctttccgcaagggggttccc
aaccccattgacctgttggagtccaccctgtacgagtcctcagtagtgcctgggcccaag
aaagcgcccatggattccttgttcgactacggcacttaccgtcaccaccccagtgacaac
aagagatggaggagaaaggtcgtggagaagcagccacagagccccaaagctcctgcaccc
cagccaccccccatcctcaaagtcttcaatcggcccatcctctttgacattgtgtcccgg
ggctccactgcggacctagatggactgctctccttcttgttgacccacaagaagcgcctg
actgatgaggagttccgggagccgtccacggggaagacctgcctgcccaaggcgctgctg
aacctaagcaacgggcgcaacgacaccatcccggtgttgctggacattgcggagcgcacc
ggcaacatgcgtgaattcatcaactcgcccttcagagacatctactaccgaggccagaca
tccctgcacattgccatcgaacggcgctgcaagcactacgtggagctgctggtggcccag
ggagccgacgtgcacgcccaggcccgcggccgcttcttccagcccaaggatgagggaggc
tacttctactttggggagctgcccttgtccctggcagcctgcaccaaccagccgcacatc
gtcaactacctgacagagaaccctcacaagaaagctgacatgaggcgacaggactcgagg
gggaacacggtgctgcacgcgctggtggccatcgccgacaacacccgagagaacaccaag
tttgtcaccaagatgtacgacctgctgcttctcaagtgttcacgcctcttccccgacagc
aacctggagacagttctcaacaatgatggcctttcgcctctcatgatggctgccaagaca
ggcaagatcggggtctttcagcacatcatccgacgtgaggtgacagatgaggacacccgg
catctgtctcgcaagttcaaggactgggcctatgggcctgtgtattcttctctctacgac
ctctcctccctggacacatgcggggaggaggtgtccgtgctggagatcctggtgtacaac
agcaagatcgagaaccgccatgagatgctggctgtagagcccattaacgaactgttgaga
gacaagtggcgtaagtttggggctgtgtccttctacatcaacgtggtctcctatctgtgt
gccatggtcatcttcaccctcaccgcctactatcagccactggagggcacgccaccctac
ccttaccggaccacagtggactacctgaggctggctggcgaggtcatcacgctcttcaca
ggagtcctgttcttctttaccagtatcaaagacttgttcacgaagaaatgccctggagtg
aattctctcttcgtcgatggctccttccagttactctacttcatctactctgtgctggtg
gttgtctctgcggcgctctacctggctgggatcgaggcctacctggctgtgatggtcttt
gccctggtcctgggctggatgaatgcgctgtacttcacgcgcgggttgaagctgacgggg
acctacagcatcatgattcagaagatcctcttcaaagacctcttccgcttcctgcttgtg
tacctgctcttcatgatcggctatgcctcagccctggtcaccctcctgaatccgtgcacc
aacatgaaggtctgtgacgaggaccagagcaactgcacggtgcccacgtatcctgcgtgc
cgcgacagcgagaccttcagcgccttcctcctggacctcttcaagctcaccatcggcatg
ggagacctggagatgctgagcagcgccaagtaccccgtggtcttcatcctcctgctggtc
acctacatcatcctcaccttcgtgctcctgttgaacatgcttatcgccctcatgggtgag
accgtgggccaggtgtccaaggagagcaagcacatctggaagttgcagtgggccaccacc
atcctggacatcgagcgttccttccctgtgttcctgaggaaggccttccgctccggagag
atggtgactgtgggcaagagctcagatggcactccggaccgcaggtggtgcttcagggtg
gacgaggtgaactggtctcactggaaccagaacttgggcatcattaacgaggaccctggc
aagagtgaaatctaccagtactatggcttctcccacaccgtggggcgccttcgtagggat
cgttggtcctcggtggtgccccgcgtagtggagctgaacaagaactcaagcgcagatgaa
gtggtggtacccctggataacctagggaaccccaactgtgacggccaccagcagggctac
gctcccaagtggaggacggacgatgccccactgtag

DBGET integrated database retrieval system