KEGG   Mus musculus (mouse): 63958
Entry
63958             CDS       T01002                                 

Gene name
Ube4b, 4930551I19Rik, 4933406G05Rik, AU014668, D4Bwg0973e, UFD2, UFD2a, Ufd2p, mKIAA0684
Definition
(RefSeq) ubiquitination factor E4B
  KO
K10597  ubiquitin conjugation factor E4 B [EC:2.3.2.27]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04120  Ubiquitin mediated proteolysis
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    63958 (Ube4b)
   04120 Ubiquitin mediated proteolysis
    63958 (Ube4b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    63958 (Ube4b)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     63958 (Ube4b)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  U-box type E3
   63958 (Ube4b)
SSDB
Motif
Pfam: Ufd2P_core U-box
Other DBs
NCBI-GeneID: 63958
NCBI-ProteinID: NP_071305
MGI: 1927086
Ensembl: ENSMUSG00000028960
Vega: OTTMUSG00000010171
UniProt: Q9ES00 Q3V426
Structure
PDB: 
2KR4

Position
4 E2; 4 79.08 cM
AA seq 1173 aa
MEELSADEIRRRRLARLAGGQTSQPTTPLTSPQRENPPGPPIAASAPGPSQSLGLNVHNM
TPATSPIGAAGVAHRSQSSEGVSSLSSSPSNSLETQSQSLSRSQSMDIDGVSCEKSMSQV
DVDSGIENMEVDENDRREKRSLSDKEPSSGPEVSEEQALQLVCKIFRVSWKDRDRDVIFL
SSLSAQFKQNPKEVFSDFKDLIGQILMEVLMMSTQTRDENPFASLTATSQPIATAARSPD
RNLMLNTGSSSGTSPMFCNMGSFSTSSLSSLGASGGASNWDSYSDHFTIETCKETDMLNY
LIECFDRVGIEEKKAPKMCSQPAVSQLLSNIRSQCISHTALVLQGSLTQPRSLQQPSFLV
PYMLCRNLPYGFIQELVRTTHQDEEVFKQIFIPILQGLALAAKECSLESDYFKYPLMALG
ELCETKFGKTHPMCNLVASLPLWLPKSLSPGSGRELQRLSYLGAFFSFSVFAEDDAKVVE
KYFSGPAITLENTRVVSQSLQHYLELGRQELFKILHSILLNGETREAALSYMAALVNANM
KKAQMQADDRLVSTDGFMLNLLWVLQQLSTKIKLETVDPTYIFHPRCRITLPNDETRINA
TMEDVNERLTELYGDQPPFSEPKFPTECFFLTLHAHHLSILPSCRRYIRRLRAIRELNRT
VEDLKNNESQWKDSPLATRHREMLKRCKTQLKKLVRCKACADAGLLDESFLRRCLNFYGL
LIQLMLRILDPAYPDVTLPLNSEVPKVFAALPEFYVEDVAEFLFFIVQYSPQVLYEPCTQ
DIVMFLVVMLCNQNYIRNPYLVAKLVEVMFMTNPSVQPRTQKFFEMIENHPLSTKLLVPS
LMKFYTDVEHTGATSEFYDKFTIRYHISTIFKSLWQNIAHHGTFMEEFNSGKQFVRYINM
LINDTTFLLDESLESLKRIHEVQEEMKNKEQWDQLPRDQQQARQSQLAQDERVSRSYLAL
ATETVDMFHLLTKQVQKPFLRPELGPRLAAMLNFNLQQLCGPKCRDLKVENPEKYGFEPK
KLLDQLTDIYLQLDCARFAKAIADDQRSYSKELFEEVISKMRKAGIKSTIAIEKFKLLAE
KVEEIVAKNARAEIDYSDAPDEFRDPLMDTLMTDPVRLPSGTVMDRSIILRHLLNSPTDP
FNRQMLTESMLEPVPELKEQIQAWMREKQSSDH
NT seq 3522 nt   +upstreamnt  +downstreamnt
atggaggagctgagcgctgacgagattcgacggaggcgcctggcacgacttgctggtgga
cagacctcccagccgaccaccccgcttacatctccccagagggagaaccctccgggacct
ccaatagctgcatcagccccaggcccctcccagagtcttggtctcaatgtccacaacatg
accccagctacctcccccataggtgcagcaggagttgcccatcggagccagagcagcgaa
ggcgtcagttctctcagcagctcaccttccaacagccttgagacacagtctcagtccctc
tcccgttcccagagcatggatattgacggtgtctcctgtgagaaaagcatgtcccaggtg
gatgtggattcgggaattgagaatatggaggtggacgagaacgaccgaagagaaaaacgg
agcctgagtgacaaggagccttcttcaggtcctgaggtgtctgaagagcaagccttacag
ctggtctgtaagatcttccgtgtctcctggaaggaccgcgacagagatgtcatcttcctt
tcttctctctctgcgcagtttaaacagaacccaaaagaagtgttctctgattttaaggat
ctgattggccagattttaatggaagtactgatgatgtcaactcagacacgagatgaaaat
ccatttgccagtctgacagccacatcccagcccatcgccacggcagctcggtcaccagac
cgcaatctcatgctgaacactggctccagttcaggaacaagccccatgttctgcaacatg
ggctccttcagcaccagctcgttgtctagtttgggagcctctggtggagcaagtaactgg
gattcgtacagtgaccatttcaccattgaaacctgcaaagagacggacatgctgaactac
ctcatcgagtgttttgaccgagttggaatagaggaaaaaaaagcaccaaagatgtgcagc
cagccagcagtcagccagcttctgagcaacatccgctcgcagtgcatctcccacaccgca
ctagtgctacaaggttccctcacacagcccaggtccttgcaacagccatccttcctcgtg
ccgtacatgctctgcaggaacctcccgtacggcttcattcaagagctggtgaggaccact
caccaggatgaagaggtgttcaagcagatctttatccccattttacaaggcctggcgctg
gctgccaaagagtgctccttggaaagcgactactttaagtaccccctcatggcactgggt
gaactctgtgaaaccaagtttgggaagacacaccctatgtgcaatttggtcgcttcttta
cccctgtggttgccgaagtccttaagccctggttctgggcgggagctgcagagactctcc
tacttaggggccttctttagcttctcagtcttcgcagaggacgatgcaaaggtggttgag
aaatacttctcagggcctgccattaccctggagaacacacgcgtggtcagccagtcacta
cagcattacctggagctgggacggcaagaacttttcaagattctacatagtattttgtta
aatggcgaaactcgtgaagcggctctcagctacatggcggcccttgtcaatgccaacatg
aagaaagcccagatgcaggcagatgatcggttggtgtctacagacgggtttatgctgaat
ctcctttgggtcctgcagcagctaagtacaaaaatcaagttagaaacagttgaccccact
tacatattccacccaagatgtcggatcactctcccgaatgatgagacacggataaatgca
acgatggaggatgtgaatgagcggctgacagagctctatggtgatcagcctccattttct
gagccaaaattccctacggaatgtttctttctcaccctgcatgctcatcacctctctatt
ctgcctagttgtcgtcgctacattcgccgacttcgagccatccgcgagctcaatagaacc
gtggaagatttgaaaaataatgaaagccagtggaaagattccccactggccaccagacac
cgtgaaatgctgaagcgctgtaaaactcagcttaagaaactggtacggtgcaaggcctgt
gctgacgctggcttacttgacgagagcttcctaagaagatgcctgaatttttatggcctt
ctcattcagctgatgctgcgcatcctggaccctgcatatcctgacgtaacactgcctttg
aattcagaagtccccaaggtatttgcagcattgcctgagttttatgtcgaagatgttgct
gaatttttattttttattgtacaatactctcctcaggtgctttatgagccctgcactcag
gacattgtcatgttcctcgttgtgatgctgtgcaaccagaactacatccgaaacccttac
ctagtggccaagctggtggaggtcatgttcatgaccaacccttctgtccagccgagaact
cagaagttctttgagatgattgagaaccatcctctctctaccaaactgctggtgccgtcc
ctcatgaagttctatacagatgtcgagcatactggagccaccagcgagttctatgacaag
ttcacaattcgctatcacattagcactatttttaaaagcctttggcaaaacatagctcac
catggcaccttcatggaggagttcaattctggaaagcagttcgttcggtatatcaatatg
ctaataaatgacacgacctttttactggacgaaagtctggagtctctgaagcggatccat
gaagtgcaagaagagatgaagaacaaagaacagtgggaccagctgcctcgggatcagcag
caggcccggcagtctcagcttgctcaggacgagcgtgtttcccgttcttatcttgccctg
gcaactgaaaccgtggacatgttccatctcctcaccaagcaagtccagaagccgttcctg
aggccagagcttggtccccgattagcagccatgctgaactttaacctgcagcagctctgc
ggacccaagtgccgggacctgaaagttgaaaacccagagaagtatggttttgagccaaag
aagctgttggaccaactgacagatatttatttacaattggactgtgctcgctttgctaaa
gccatcgccgatgaccagcgatcctacagcaaggaactgtttgaagaagtcatttcaaag
atgcggaaggcgggaatcaaatccaccatcgcaatagagaagtttaaacttcttgcagag
aaagtggaggaaatcgtggcaaagaatgcgcgggcagaaatagactacagcgatgccccg
gacgagttcagagaccctctgatggacaccctgatgaccgatcccgtgagactgccctct
ggcaccgtcatggaccgttctatcatcctgcggcatctgctcaactcccccaccgacccc
ttcaaccgccagatgctgactgagagcatgctggagccagtgccagagctaaaggagcag
attcaggcctggatgagagagaaacagagcagtgaccactga

DBGET integrated database retrieval system