KEGG   Mus musculus (house mouse): 63985
Entry
63985             CDS       T01002                                 
Symbol
Gmfb, 3110001H22Rik, 3110001O16Rik, AI851627, C79176, D14Ertd630e
Name
(RefSeq) glia maturation factor, beta
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: Cofilin_ADF
Other DBs
NCBI-GeneID: 63985
NCBI-ProteinID: NP_071306
MGI: 1927133
Ensembl: ENSMUSG00000062014
UniProt: Q9CQI3
Structure
Position
14:complement(47045606..47059711)
AA seq 142 aa
MSESLVVCDVAEDLVEKLRKFRFRKETHNAAIIMKIDKDERLVVLDEELEGVSPDELKDE
LPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKV
FEIRNTEDLTEEWLREKLGFFH
NT seq 429 nt   +upstreamnt  +downstreamnt
atgagtgagtctttggtggtttgtgatgttgctgaagatttagtggaaaagctgagaaag
tttcgttttcgaaaagaaacccacaatgctgctattataatgaagattgacaaggatgaa
cgcctggtggtgctggatgaggagctcgagggtgtctctccagatgaacttaaagacgaa
ctacccgagcggcagcctcgcttcattgtgtatagttataaataccaacatgatgatggc
agagtctcgtacccgctctgctttattttctccagtcctgtcgggtgtaagcctgagcag
cagatgatgtacgctgggagtaagaacaagctagtccagactgccgagctaaccaaggta
tttgaaataagaaacactgaagatctaactgaagaatggttacgtgagaaacttggattt
ttccactaa

DBGET integrated database retrieval system