KEGG   Mus musculus (mouse): 63993Help
Entry
63993             CDS       T01002                                 

Gene name
Slc5a7, CHT1
Definition
(RefSeq) solute carrier family 5 (choline transporter), member 7
  KO
K14387  solute carrier family 5 (high affinity choline transporter), member 7
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04725  Cholinergic synapse
mmu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    63993 (Slc5a7)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    63993 (Slc5a7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    63993 (Slc5a7)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC5: Sodium glucose cotransporter
   63993 (Slc5a7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SSF
Motif
Other DBs
NCBI-GeneID: 63993
NCBI-ProteinID: NP_071308
MGI: 1927126
Ensembl: ENSMUSG00000023945
UniProt: Q8BGY9
Position
17; 17 C
AA seq 580 aa AA seqDB search
MSFHVEGLVAIILFYLLIFLVGIWAAWKTKNSGNPEERSEAIIVGGRDIGLLVGGFTMTA
TWVGGGYINGTAEAVYGPGCGLAWAQAPIGYSLSLILGGLFFAKPMRSKGYVTMLDPFQQ
IYGKRMGGLLFIPALMGEMFWAAAIFSALGATISVIIDVDVNISVIVSALIAILYTLVGG
LYSVAYTDVVQLFCIFIGLWISVPFALSHPAVTDIGFTAVHAKYQSPWLGTIESVEVYTW
LDNFLLLMLGGIPWQAYFQRVLSSSSATYAQVLSFLAAFGCLVMALPAICIGAIGASTDW
NQTAYGYPDPKTKEEADMILPIVLQYLCPVYISFFGLGAVSAAVMSSADSSILSASSMFA
RNIYQLSFRQNASDKEIVWVMRITVLVFGASATAMALLTKTVYGLWYLSSDLVYIIIFPQ
LLCVLFIKGTNTYGAVAGYIFGLFLRITGGEPYLYLQPLIFYPGYYSDKNGIYNQRFPFK
TLSMVTSFFTNICVSYLAKYLFESGTLPPKLDVFDAVVARHSEENMDKTILVRNENIKLN
ELAPVKPRQSLTLSSTFTNKEALLDVDSSPEGSGTEDNLQ
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgtctttccacgtagaaggactggtagctattatcctcttctacctccttatatttctg
gttggaatatgggctgcatggaaaaccaaaaacagcggcaacccagaagagcgcagtgaa
gccatcatagtcgggggccgtgacattggtttgttggttggtggttttaccatgacagcc
acctgggttggaggaggctacatcaatgggacagcagaagcagtgtatgggccaggttgt
ggtctagcttgggctcaggcacccattggatattctctgagtctaattttaggtggtctg
ttttttgcgaaacctatgcgttccaagggatatgtgactatgttagacccatttcaacag
atctatggaaagcgcatgggtgggctgctcttcatccctgcactgatgggagagatgttc
tgggctgcagcaattttctctgcattaggggccaccatcagcgtgatcattgatgtggat
gtgaacatatcggtcattgtctctgcactcattgccattctttataccctagtgggtggg
ctctactctgtggcatatactgatgttgtccagctattctgcatttttataggactgtgg
atcagtgtcccttttgccctgtcacatcctgcagtcaccgacatcggattcacagctgtg
catgctaaataccagagtccctggctgggaaccattgaatcagttgaagtctacacctgg
cttgataattttctgttattgatgctgggtggaatcccatggcaagcctacttccagagg
gtcctctcttcatcctcagccacctatgctcaggtactgtccttcctggcagcttttggg
tgcctggtgatggctctacccgccatatgcataggagctattggagcttccacagactgg
aaccagactgcctacgggtatccagatcccaagactaaggaggaagcagacatgattctc
ccgatcgttctgcagtacctctgccctgtgtacatctccttctttgggcttggtgctgtt
tcagctgctgtcatgtcctcagctgactcgtccatcctgtcggcgagttctatgtttgct
cggaatatctaccagctttccttcagacaaaatgcatcagacaaggaaattgtgtgggtc
atgaggatcactgtgcttgtgttcggagcatctgcaacagccatggctttgctgacgaag
actgtgtatgggctctggtacctgagctctgaccttgtctacatcatcatcttcccacag
ctgctctgtgtactcttcatcaaaggaaccaacacttatggggcagttgctggttatatt
tttggactattcctgagaattactggaggagagccatatctatacttgcagcccttaatc
ttctaccctggttattactctgacaagaatggtatatacaatcagaggttcccatttaaa
actctctccatggttacctcattctttaccaacatttgtgtttcttatctagccaagtat
ctatttgaaagtggaaccttgcctccaaaattagatgtatttgatgctgttgtcgcaagg
cacagtgaagagaacatggacaagaccattctagtcagaaatgaaaatatcaaattaaat
gaacttgcacctgtgaaacctcggcagagcctaaccctcagttcaactttcaccaataag
gaggccctccttgatgttgattccagtccggaggggtctgggactgaagataacttacaa
tga

DBGET integrated database retrieval system