KEGG   Mus musculus (house mouse): 64008
Entry
64008             CDS       T01002                                 
Symbol
Aqp9, 1700020I22Rik, AQP-9
Name
(RefSeq) aquaporin 9
  KO
K09877  aquaporin-9
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04613  Neutrophil extracellular trap formation
mmu04976  Bile secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    64008 (Aqp9)
  09154 Digestive system
   04976 Bile secretion
    64008 (Aqp9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    64008 (Aqp9)
Transporters [BR:mmu02000]
 Other transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaglyceroporins or glycerol-uptake facilitators
    64008 (Aqp9)
SSDB
Motif
Pfam: MIP PMP22_Claudin
Other DBs
NCBI-GeneID: 64008
NCBI-ProteinID: NP_071309
MGI: 1891066
Ensembl: ENSMUSG00000032204
Position
9:complement(71017941..71075170)
AA seq 295 aa
MPSEKDRAKKNLVQRLALKSCLAKETLSEFLGTFIMIVLGCGSIAQAVLSREKAGGIITI
NIGFATAVVMALYATFGVSGGHINPAVSFAMCTFGRMEWFKFPFYVGAQLLGAFVGAATV
FGIYYDGLMAFADGKLLITGENGTAFIFATYPKPFVSVPGAFVDQVVSTMFLLLIVFAIF
DSRNLGVPRGLEPIVIGLLIIVISCSLGLNSGCAMNPARDLSPRLFTALAGWGFEVFTFG
NNFWWIPVVGPMIGAVLGGLIYVLFIQMHHSNPDPEVKAEPAENNLEKHELSVIM
NT seq 888 nt   +upstreamnt  +downstreamnt
atgccttctgagaaggaccgagccaagaagaacctcgtgcagaggctggccctgaagagc
tgtctggctaaggagacactctctgagttcctgggcacctttataatgattgtccttgga
tgtggctctattgctcaagcagtcctcagtcgagaaaaggctggtgggatcatcactatc
aatattggatttgcaacggcagttgtgatggctctttatgcgacttttggtgtctctggg
ggccacatcaacccagcggtgtcttttgcaatgtgcacctttggaaggatggagtggttc
aagttccccttttatgtgggagctcagcttttgggagcctttgtcggggctgcaactgtc
tttggcatttactatgacggactcatggcctttgctgatggaaagctgctcatcacggga
gaaaatggaacggcgttcattttcgcgacatacccaaaaccatttgtatccgtgccaggt
gcctttgtagaccaagtggtgtctaccatgttcctccttctgattgtctttgccatcttt
gactccagaaacctgggggtccccagaggcctggagcccattgtcattggcctcctaatc
attgtcatttcctgttctctcggactcaactctggttgtgccatgaaccctgctcgagac
ctcagccccaggctcttcactgctctggcaggatggggatttgaggtcttcacatttgga
aataacttctggtggatacctgtcgtgggccctatgattggagctgtcctgggaggtctc
atctatgttctttttatccaaatgcatcactcgaaccccgacccagaagtgaaggcagaa
ccagccgagaacaatctagaaaaacacgaactcagcgtcatcatgtag

DBGET integrated database retrieval system