KEGG   Mus musculus (mouse): 64008Help
Entry
64008             CDS       T01002                                 

Gene name
Aqp9, 1700020I22Rik, AI266899, AQP-9
Definition
(RefSeq) aquaporin 9
  KO
K09877  aquaporin-9
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04976  Bile secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    64008 (Aqp9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    64008 (Aqp9)
Transporters [BR:mmu02000]
 Other Transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaglyceroporins or glycerol-uptake facilitators
    64008 (Aqp9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MIP Phage_holin_5_2
Motif
Other DBs
NCBI-GeneID: 64008
NCBI-ProteinID: NP_071309
MGI: 1891066
Ensembl: ENSMUSG00000032204
Vega: OTTMUSG00000023895
UniProt: Q9JJJ3 Q4FK77
Position
9; 9 D
AA seq 295 aa AA seqDB search
MPSEKDRAKKNLVQRLALKSCLAKETLSEFLGTFIMIVLGCGSIAQAVLSREKAGGIITI
NIGFATAVVMALYATFGVSGGHINPAVSFAMCTFGRMEWFKFPFYVGAQLLGAFVGAATV
FGIYYDGLMAFADGKLLITGENGTAFIFATYPKPFVSVPGAFVDQVVSTMFLLLIVFAIF
DSRNLGVPRGLEPIVIGLLIIVISCSLGLNSGCAMNPARDLSPRLFTALAGWGFEVFTFG
NNFWWIPVVGPMIGAVLGGLIYVLFIQMHHSNPDPEVKAEPAENNLEKHELSVIM
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgccttctgagaaggaccgagccaagaagaacctcgtgcagaggctggccctgaagagc
tgtctggctaaggagacactctctgagttcctgggcacctttataatgattgtccttgga
tgtggctctattgctcaagcagtcctcagtcgagaaaaggctggtgggatcatcactatc
aatattggatttgcaacggcagttgtgatggctctttatgcgacttttggtgtctctggg
ggccacatcaacccagcggtgtcttttgcaatgtgcacctttggaaggatggagtggttc
aagttccccttttatgtgggagctcagcttttgggagcctttgtcggggctgcaactgtc
tttggcatttactatgacggactcatggcctttgctgatggaaagctgctcatcacggga
gaaaatggaacggcgttcattttcgcgacatacccaaaaccatttgtatccgtgccaggt
gcctttgtagaccaagtggtgtctaccatgttcctccttctgattgtctttgccatcttt
gactccagaaacctgggggtccccagaggcctggagcccattgtcattggcctcctaatc
attgtcatttcctgttctctcggactcaactctggttgtgccatgaaccctgctcgagac
ctcagccccaggctcttcactgctctggcaggatggggatttgaggtcttcacatttgga
aataacttctggtggatacctgtcgtgggccctatgattggagctgtcctgggaggtctc
atctatgttctttttatccaaatgcatcactcgaaccccgacccagaagtgaaggcagaa
ccagccgagaacaatctagaaaaacacgaactcagcgtcatcatgtag

DBGET integrated database retrieval system