KEGG   Mus musculus (mouse): 64009Help
Entry
64009             CDS       T01002                                 

Gene name
Syne1, 8B, A330049M09Rik, BE692247, C130039F11Rik, CPG2, KASH1, Myne1, mKIAA1756, myne-1
Definition
(RefSeq) spectrin repeat containing, nuclear envelope 1
  KO
K19326  nesprin-1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    64009 (Syne1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   LINC complex
    64009 (Syne1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Spectrin KASH
Motif
Other DBs
NCBI-GeneID: 64009
NCBI-ProteinID: NP_001073154
MGI: 1927152
Ensembl: ENSMUSG00000096054
Vega: OTTMUSG00000063506
UniProt: Q6ZWR6 Q6PI72
Position
10; 10 A1
AA seq 3010 aa AA seqDB search
MFPQELAQKIKGYQEQIDSLNSKCKMLTMKAKHATMLLTVTEVEGLAEGTEDLDRELHPT
PSAHPSVVMMTAGRCHTLLSPVTEESGEEGTNSEISSPPACRSPSPVANTEAAVNQDIAY
YQALSAEGLQTDAARIPPSAAVSQELYEPGLEPSATAKLGDLQRSWETLKNVISEKQRTL
YEVLERQQKYQDSLQSISTKMEAMEMKLGESLEPSRSPESQMAEHQALMDEVQMLQDEIN
GLQVSLAEELVAESQESDPAEQLALQSTLTVLAERMSTIRMKAAGKRQLLEEKLSDQLEE
QRQEQALQRYRCEADELDHWLLNTKATLDVALGTSQEPMDMDAQLVDCQNMLVEIEQKVV
ALSQLSVHNENLLLEGKAHTKEEAEQLAVKLRLLKGSLGELQRALHDRQLDMQGVTQEKE
ENDVDFTDTQSPGVQEWLAQARTTRTHQRQSSLQQQKEFEQELAEQKSLLRSVASRGEEI
LTQHSTAEGSGGLGEKPDVLSQELGIAEDQMRVKWESLHQEFSAKQKLLQNILEQEQEQV
LYSSPNRLLSGVLPFRGEAQTQDKTSVTSLLDGLSQAFGEASSQSGGTDRQSIHLEQKLY
DGVSATSTWLNDVEERLFVATAPLPEETEACLFNQEALAKDIKEMSEEMDKNKNLFSQAF
PEDSDNRDVIEDTLGCLLGRLSLLDSVVDQRCHQMKERLQQILRFQNDLKVLFTSLADSK
YIILQKLANVFEQPIVEQMQAIQQAEEGLRDLEGGISELKRWADKLQVEQSAVQELSKLQ
DMYDELLMTVSSRRSSLHQNLALKSQYDKALQDLVDLLDTGQEKMTGDQKIIVCSKEEIQ
QLLGKHKEYFQGLESHMILTEILFRKIVGFAAVKETQFHTDCMAQASAVLKQAHKRGVEL
EYILEMWSHLDENRQELSRQLEVIENSIPSVGLVEESEDRLVERTNLYQHLKSSLNEYQP
KLYQALDDGKRLLMSVSCSELESQLNQLGEHWLSNTNKVSKELHRLETILKHWTRYQSEA
AALNHWLQCAKDRLAFWTQQSVTVPQELEMVRDHLSAFLEFSKEVDAKSALKSSVTSTGN
QLLRLKKVDTAALRAELSRMDSQWTDLLTGIPVVQEKLHQLQMDKLPSRHAISEVMSWIS
LMESVILKDEEDIRNAIGYKAIHEYLQKYKGFKIDLNCKQLTADFVNQSVLQISSQDVES
KRSDKTDFAEQLGAMNKSWQLLQGRVGEKIQMLEGLLESWSEYENSVQSLKAWFANQERK
LKEQHLLGDRNSVENALKDCQELEDLIKAKEKEVEKIEQNGLALIQNKREEVSGSVMSTL
QELRQTWISLDRTVEQLKIQLTSALGQWSNHKAACDEINGHLMEARYSLSRFRLLTGSSE
AVQVQVDNLQNLHDELEKQEGGLQKFGSITNQLLKECHPPVAETLSSTLQEVNMRWNNLL
EEIAEQLHSSKALLQLWQRYKDYSKQCASAIQRQEEQTSVLLKAATNKDIADDEVTKWIQ
DCNDLLKGLETVKDSLFILRELGEQLGQQVDVSAAAAIQCEQLCFSQRLGALEQALCKQQ
AVLQAGVVDYETFAKSLEALEVWMVEAEGILQGQDPTHSSDLSTIQERMEELKGQMLKFS
SLAPDLDRLNELGYRLPLNDKEIKRMQNLNRHWSLTSSQTTERFSKLQSFLLQHQTFLEK
CETWMEFLVQTEHKLAVEISGNYQHLLEQQRAHELFQAEMFSRQQILHSIIVDGQNLLEQ
GQVDDREEFSLKLTLLSNQWQGVIRRAQQRRGIIDSQIRQWQRYREMAEKLRKWLAEVSH
LPLSGLGNIPVPLQQVRMLFDEVQFKEKVFLRQQGSYILTVEAGKQLLLSADSGAEAALQ
AELTDIQEKWKAASMHLEEQKKKLAFLLKDWEKCERGIANSLEKLRMFKKRLSQPLPDHH
EELHAEQMRCKELENAVGRWTDDLTELMLVRDALAVYLSAEDISMLKERVELLQRQWEEL
CHQVSLRRQQVSERLNEWAVFSEKNKELCEWLTQMESKVSQNGDILIEEMIEKLKKDYQE
EIAVAQENKIQLQEMGERLAKASHESKASEIQYKLSRVKDRWQHLLDLMAARVKKLKETL
VAVQQLDKNMGSLRTWLAHMESELAKPIVYDSCNSEEIQRKLNEQQELQRDIEKHSTGVA
SVLNLCEVLLHDCDACATDAECDSIQQATRNLDRRWRNICAMSMERRLKIEETWRLWQKF
LDDYSRFEDWLEVSERTAAFPSSSGVLYTVAKEELKKFEAFQRQVHESLTQLELINKQYR
RLARENRTDSACSLRQMVHGGNQRWDDLQKRVTSILRRLKHFISQREEFETARDSILVWL
TEMDLQLTNIEHFSECDVQAKIKQLKAFQQEISLNHNKIEQIIAQGEQLIEKSEPLDAAV
IEEELDELRRYCQEVFGRVERYHKKLIRLPLPDDHDLSDRELDLEDSTALSDLRWQDPSA
DGMPSPQPSSNPSLSLPQPLRSERSGRDTPASVDSIPLEWDHDYDLSRDLESASRTLPSE
DEEGEEDKEFYLRGAVGLSGDPSSLESQMRQLDKALDDSRFQIQQTANILRSKTPTGPDL
DTSYKGYMKLLGECSGSIDSVRRLEHKLAEEESFPGFVNLNSTETQTAGVIDRWELLQAQ
AMSKELRMKQNLQKWQQFNSDLNNIWAWLGETEEELDRLQHLALSTDIHTIESHIKKLKE
LQKAVDHRKAIILSINLCSSEFTQADSKESHDLQDRLSQMNGRWDRVCSLLEDWRGLLQD
ALMQCQEFHEMSHALLLMLENIDRRKNEIVPIDSTLDPETLQDHHKQLMQIKQELLKSQL
RVASLQDMSRQLLVNAEGSDCLEAKEKVHVIGNRLKLLLKEVSHHIKDLEKLLDMSSSQQ
DLSSWSSADELDTSGSVSPTSGRSTPNRQKSPRGKCSLSQPGPSVSSPKSRSTRDGSDSS
RSDPRPERVGRAFLFRILRAALPFQLLLLLLIGLTCLVPMSEKDYSCALSNNFARSFHPM
LRYTNGPPPL
NT seq 9033 nt NT seq  +upstreamnt  +downstreamnt
atgtttcctcaggagctggcgcagaaaatcaagggctaccaggagcagatcgactctttg
aattccaaatgcaagatgctgacgatgaaagccaagcacgcaactatgctgctgactgtg
accgaggtcgagggactggctgaagggaccgaggatctggaccgcgagctccaccctacg
ccttcagcccacccctctgtggtcatgatgactgcaggtcgctgtcatactctgctgtca
cctgtcactgaagagtctggggaagagggaaccaacagtgagatttcctctccacctgcc
tgtcgctccccatcacctgtggctaacacggaggcggctgttaaccaggacattgcgtac
taccaagctctgtcagccgaggggttgcagacagatgctgcaagaattccccccagtgct
gctgtatcccaagagttgtatgagccaggactggagccttcagcgactgccaagctgggt
gacttacaacgttcctgggaaaccttaaaaaacgtgatcagtgagaaacagcggactctc
tacgaagttttggaacgccagcagaagtaccaagactctctccaatccatctcgactaaa
atggaggccatggagatgaagctaggtgagagcctcgagcccagccggagtccagagagc
cagatggctgagcaccaggccctgatggacgaggtgcagatgctacaagacgagatcaat
gggctccaggtgtctcttgctgaggagctggtggccgagtctcaggagtcggaccccgcg
gagcagctagctctgcagtccacgctcactgtcctggctgagagaatgtccaccatcagg
atgaaagcagctggcaagcggcagcttctggaggagaagctaagtgatcagctggaggag
cagagacaggagcaggctctgcagaggtaccgctgcgaggcagatgagctggaccactgg
ctgctgaacactaaggctaccctggatgttgcactgggtacatcccaggagcccatggac
atggatgcccagctggtggactgccagaacatgctggtggaaatcgaacagaaagtggtg
gccctgtcgcagctgtccgtgcacaatgagaacctgctgttggagggcaaggctcacact
aaagaggaggccgagcagctagcggtgaagctgaggctactcaaagggagccttggagag
ctgcagagggccctgcatgacagacagctcgacatgcagggagtcacacaagagaaagag
gagaacgatgttgacttcacagacacccagagccccggcgtgcaggaatggctggcacaa
gcccgcaccacaaggacccaccagcggcagagcagcctccagcagcaaaaagagttcgaa
caggagctggccgagcagaagagcctcctccgctcagtagctagccgtggagaggagatt
ctaacccaacattccaccgcagaaggttcaggtggccttggtgaaaaacctgatgtgtta
tcccaggagttggggattgctgaagaccagatgagagtgaagtgggaaagcctacaccaa
gagtttagtgccaagcagaagctactacagaatattctggaacaggagcaagaacaagtg
ctttacagtagtccgaacagactcctgtcaggagtacttccattcagaggggaagcacag
actcaggataagacttcagtgacgtccttgctggatgggctgagccaggccttcggggag
gcgtcatcacagagtggagggacagacagacagagcattcacttggagcagaagctatat
gacggagtctcagccacttccacctggttgaatgacgtcgaggagcgcttatttgtagcc
acggcacctttgccagaagaaacagaagcttgtctcttcaaccaggaggctcttgccaag
gacattaaggaaatgtctgaagaaatggataagaacaagaacttgttttcccaagcattc
ccagaggacagtgacaaccgggatgtcattgaagatactctgggttgtcttttgggcaga
ttgtccctgctggattcagtagtggatcagcggtgtcatcagatgaaggaaagactccag
caaatcctccgtttccagaatgacctgaaggtgttgtttacatcgttagctgacagcaaa
tatatcattctgcagaagctggcaaatgtgtttgaacagcccattgtggaacagatgcag
gccatccaacaggctgaagagggactcagggacctcgagggtggaatctctgagttgaaa
cggtgggctgacaagttgcaagtggaacagtctgctgtgcaggaactctccaagctccag
gacatgtatgacgagctattgatgactgtcagctcccggaggagcagcctccaccagaac
cttgctctcaagagtcagtatgataaggctctgcaagatctggtggacctgctggacact
ggacaggagaagatgacaggggaccaaaagatcattgtatgctccaaagaagaaatccag
cagctgcttgggaagcacaaggaatacttccagggcctggaatcgcacatgattttgact
gaaatactcttcaggaagatcgttggctttgcagctgtgaaggaaactcagttccatacg
gactgcatggctcaggcctctgctgtgttgaagcaggctcacaagagaggggtggagctt
gagtacatcctagagatgtggtcccatctggatgagaatcgccaggagctcagcagacag
ctggaggtgatagaaaacagcatcccaagtgtgggcctggtagaagagagtgaggacaga
cttgtggaaaggacaaatctctaccagcatttaaaatccagcctcaatgaataccagccc
aaactgtaccaagcactggatgatgggaagcgacttctgatgtctgtcagctgttcagag
cttgaaagtcagctaaatcagctgggagagcactggctcagtaatacgaacaaagtatcc
aaggagctgcacagactggagaccatactgaaacactggaccagatatcaaagtgaagct
gcagctctcaaccactggctacagtgcgctaaggacaggctggcattttggactcagcag
tctgtgacggttccacaagaactggaaatggtccgggatcatctcagtgctttcctggag
ttctctaaagaagtagatgccaagtctgccctcaagtcgtcagtcacaagcacaggaaat
cagctgcttcggttaaaaaaagtggacacagcggccctgcgtgctgagctgtcccgcatg
gacagccagtggactgacctactgaccggcatccctgttgtacaggagaagctccatcag
ctccagatggacaagctgccttcccgccatgccatttctgaggtaatgagttggatctca
ctcatggaaagtgttatcctgaaggatgaagaggacattagaaatgccatcggttacaag
gcgatccacgaataccttcagaaatacaagggtttcaagatagaccttaactgcaagcag
ctaacggcggactttgtgaaccagtcagtgctccaaatcagcagtcaggacgtggagagc
aagcgcagtgacaagacggattttgctgagcagcttggggcaatgaataaaagttggcag
ctcttgcaaggtcgagttggagagaagatccagatgttggaaggcttgttggagtcatgg
tcagagtatgaaaacagtgtccagtctctgaaagcctggtttgcaaaccaggagaggaag
ctgaaagagcagcatctacttggcgatcggaattctgttgagaatgctctgaaggactgt
caggaactggaagatttgattaaagcaaaagaaaaggaggtagagaaaattgagcagaat
ggcctcgcattgattcagaacaagagggaggaggtctctggcagtgtcatgagcacactg
caagaactcaggcagacctggatcagtttagaccgcacggttgaacaattaaagatccag
ctgacctcagcccttggccagtggagcaatcacaaagcagcctgtgacgagatcaacggt
cacctcatggaggccagatactccctgtcccgattccgtctgttgacaggttcctccgaa
gctgtacaagttcaggtcgacaatcttcagaatcttcatgatgaactagaaaaacaggaa
ggaggcttacagaaatttggctctatcaccaaccaactattgaaggagtgtcacccacct
gtggcagaaaccctctccagtactctgcaagaagtcaatatgagatggaataacttactg
gaagagatcgctgaacagctgcactccagcaaggccctccttcagctctggcagagatac
aaggactactcaaagcagtgtgcctctgccatccagagacaagaggaacagaccagtgta
ctgttgaaggcagccactaacaaggatatcgctgatgatgaagtcaccaagtggattcag
gattgcaacgaccttctcaagggactggagacagtcaaggactcgcttttcatcctccgt
gaactaggagagcagcttggacagcaggtggatgtttccgcagcagcagccattcagtgt
gagcagctctgtttcagccagcgcctgggggccctggagcaggctctttgcaagcagcaa
gcagtattgcaggctggagttgttgactatgaaacatttgccaagagcttagaagcctta
gaggtctggatggtggaagccgagggcatcctccaaggacaggatcccacccattcctct
gacctctctactatccaggaaaggatggaggaactgaagggacagatgctaaagttcagc
agcttggctcctgatttagaccgtctcaatgagttggggtaccggttacccttaaatgac
aaggagatcaagaggatgcagaacctgaaccgccattggtctctgacctcttctcagacc
acagaaagattcagcaagttgcagtcattcttgcttcagcaccagactttcttggaaaag
tgtgagacatggatggaatttctggttcagacagagcacaagttggcagtggagatctca
ggcaattaccagcatcttttggagcagcaaagagcacatgagctttttcaagccgagatg
ttcagccgccagcagatcctccactccatcattgttgatgggcagaatcttctagaacaa
ggtcaagttgatgatagggaagagttcagcctgaagttgacgctcctcagtaaccagtgg
cagggagtgattcgaagggcccaacagagaagggggatcattgacagccagattcgccag
tggcaacgctatagggaaatggcagagaagctccgtaaatggttggctgaggtgtctcat
ctgcccctgagtggtctcgggaacatcccagtaccactgcaacaagtgaggatgctcttt
gatgaagttcagttcaaagagaaggtgttcctgcgccagcaagggagctacatcctgaca
gtggaggctggcaagcagctcctgctctctgccgacagtggcgccgaggccgccctgcag
gctgagctcacagacatccaagagaagtggaaggcagccagcatgcatctggaggagcag
aagaaaaagctggcttttctgttgaaagactgggaaaaatgtgagagagggatagccaat
tctctggagaagctccgaatgttcaaaaagaggttatctcagcctctacctgaccaccat
gaggaacttcatgcagagcagatgcggtgtaaggaactggaaaacgcagttgggaggtgg
acagatgacctgacagagttgatgctggtgagggatgccctggctgtctacctcagtgct
gaggacatctccatgctgaaggaacgcgtggagcttctgcaaagacaatgggaagagctt
tgtcaccaggtctccctacgacgacagcaagtaagcgagcgcctgaatgagtgggctgtc
ttcagtgaaaagaacaaggagctgtgtgagtggctgacccagatggagagcaaagtctct
cagaacggagacattctcatcgaagagatgatagaaaaactcaagaaggattatcaagag
gaaattgctgttgcccaagagaacaaaatccagcttcaggaaatgggagaacggcttgct
aaagccagccacgagagcaaagcctctgagattcagtacaagctcagcagagtgaaggac
aggtggcagcatctcctggacctcatggcagctagggtgaagaagctaaaggagacgctg
gttgctgtgcagcagctggacaagaacatgggcagcctgaggacttggctggcccacatg
gagtcagagttggccaagcccatagtctatgattcttgtaactctgaagaaatacagagg
aaactgaatgagcagcaggagctccagagagacatcgagaaacacagcacaggtgtcgcc
tccgtcctcaacctgtgtgaggttctgctgcatgactgcgacgcctgtgccaccgacgca
gagtgtgactccatccagcaggccactcgcaacctggaccggcggtggaggaacatctgc
gccatgtccatggagaggagactcaaaattgaagagacgtggcgactgtggcagaagttt
ctggatgactattctcgctttgaagactggctggaggtttcagaaaggacggctgctttc
cccagttcttccggggtgctctatacagttgccaaggaggagctgaagaagtttgaggct
ttccagcggcaggtccatgagagcctgacccaactagagcttatcaacaaacagtaccgg
cgcctggccagagagaatcgcacagactccgcctgcagcctcaggcagatggtccatggg
ggcaaccagagatgggacgacctacagaagcgggtcacctccatcttgcgcaggctcaag
cacttcattagccagcgtgaggagttcgagactgcccgggacagcattcttgtctggctc
acagagatggatctgcagctcaccaatattgaacacttttcggaatgtgacgttcaagct
aaaataaagcaactcaaggctttccaacaggagatctcactgaaccacaataaaatcgag
cagatcattgcccagggggagcagctgatagagaagagcgagccactggatgccgctgtc
atcgaggaggaactggacgagctcagacgctactgccaggaggtctttggacgtgtggaa
agatatcacaagaaactgatccgcctgcctctgccagatgaccatgacctctcagaccga
gaactagatctcgaagactccacggctctttcagacctccgctggcaggacccgtctgca
gatggcatgccctccccacagccttcttccaacccctccctctcccttcctcagcccctc
cggagtgagcggtcagggcgagatacgccggccagcgtggactccatccccctggaatgg
gaccacgattacgacctcagtcgagacctagagtcagcatcccgaactctgccctcagaa
gatgaagaaggcgaggaagacaaggagttctacctcaggggagctgttggcttgtcaggg
gatcccagctcactggagtcacagatgaggcaactggacaaagccctggatgacagccgc
ttccagatacagcaaaccgcaaatatcctcagaagcaaaacccccacagggccagacctg
gacaccagctacaagggctacatgaagctgctgggcgagtgcagtggcagcatagattcc
gtgaggagactggagcacaagctggcggaggaagagagctttcctggcttcgttaacctc
aacagcacagagactcagacagctggtgtaattgaccgctgggagctcctgcaggcccag
gcaatgagcaaggagttgaggatgaagcagaaccttcagaagtggcagcagtttaattct
gacctcaacaacatctgggcctggctaggagagacagaggaggagctggacaggctccag
cacctggcgctcagcactgacatccacaccatcgagtctcacatcaaaaagctcaaggag
ctccagaaagccgtggaccaccgcaaagccatcatcctctccatcaacctctgcagctct
gagttcacccaggctgacagcaaagagagtcatgacctgcaggatcgcttatcccagatg
aatgggagatgggatcgagtgtgctctctgctggaggactggagaggcttgctgcaggat
gcactgatgcagtgccaggagttccatgaaatgagccatgccttgcttctcatgctagaa
aacattgacagaaggaaaaatgaaattgtcccaattgattcaacccttgacccagagaca
cttcaggaccatcacaagcaactcatgcaaataaagcaggagttgctgaagtcccaactc
agagtggcctcactacaagacatgtctcgccaactcttggtgaatgctgaaggttcagat
tgtctagaagccaaagaaaaggtccatgtgattggaaaccggctcaaacttctcctgaag
gaggtcagccatcatatcaaggatcttgagaagttactagacatgtcaagcagtcagcag
gatttgtcatcatggtcttctgcagatgagctggacacctcaggatctgtgagtcccaca
tccggaagaagtaccccaaacagacagaaatcgccacgaggcaaatgtagtctctcacag
cctggaccctctgtcagcagcccaaagagcaggtccacaagagatggctccgattcctcc
cgttctgaccccaggccagaacgggtgggtcgagccttcctgttccggatcctccgggca
gctcttccctttcagctgctcctgctgctgcttattggactcacctgccttgtacccatg
tcagagaaagactacagctgtgccctctccaacaactttgcccgatccttccatccgatg
ctcagatataccaacggtcctcctccactctga

DBGET integrated database retrieval system