KEGG   Mus musculus (mouse): 64050
Entry
64050             CDS       T01002                                 

Gene name
Yeats4, 4930573H17Rik, B230215M10Rik, GAS, GAS41, NuBI, NuBI-1
Definition
(RefSeq) YEATS domain containing 4
  KO
K11341  YEATS domain-containing protein 4
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    64050 (Yeats4)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     64050 (Yeats4)
    NuA4 complex
     64050 (Yeats4)
  Chromatin remodeling factors
   SRCAP complex
    64050 (Yeats4)
   SWR1 complex
    64050 (Yeats4)
Motif
Pfam: YEATS SOGA RIC3
Other DBs
NCBI-GeneID: 64050
NCBI-ProteinID: NP_080846
MGI: 1927224
Ensembl: ENSMUSG00000020171
UniProt: Q9CR11
Position
10; 10 D2
AA seq 227 aa
MFKRMAEFGPDSGGRVKGVTIVKPIVYGNVARYFGKKREEDGHTHQWTVYVKPYRNEDMS
AYVKKIQFKLHESYGNPLRVVTKPPYEITETGWGEFEIIIKIFFIDPNERPVTLYHLLKL
FQSDTNAMLGKKTVVSEFYDEMIFQDPTAMMQQLLTTSRQLTLGAYKHETEFAELEVKTR
EKLEAAKKKTSFEIAELKERLKASRETINCLKNEIRKLEEDDQTKDI
NT seq 684 nt   +upstreamnt  +downstreamnt
atgttcaagagaatggcggaatttggacctgactccggcgggagagtgaagggggttacc
atcgttaagccaatcgtttatggcaatgttgccaggtactttggaaagaagagagaagaa
gacgggcacactcaccagtggactgtgtacgtgaagccctacagaaacgaggatatgtca
gcatatgtgaagaagatccagtttaaattacacgaaagctacggcaatcctctaagagtc
gtcaccaagcctccatatgaaatcacagaaacaggatggggtgaatttgaaatcatcatc
aagatatttttcattgaccccaacgagagacctgtgactctgtaccacttactgaagctc
ttccagtctgacaccaatgccatgctggggaagaaaacagtggtttcagagttctatgac
gaaatgatatttcaagacccaacggcaatgatgcagcagctgcttacgacgtctcgccag
ctgacattgggagcctataagcacgaaacagagtttgcagaacttgaagtgaaaaccaga
gaaaaattagaagctgccaagaaaaaaacaagctttgagattgcggagcttaaggagaga
ttaaaagcaagtcgtgaaactataaactgtttaaaaaatgaaatcaggaagcttgaagaa
gacgatcagacgaaagacatttga

DBGET integrated database retrieval system