KEGG   Mus musculus (mouse): 64051
Entry
64051             CDS       T01002                                 

Gene name
Sv2a, AI746429, mKIAA0736
Definition
(RefSeq) synaptic vesicle glycoprotein 2 a
  KO
K06258  MFS transporter, VNT family, synaptic vesicle glycoprotein 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    64051 (Sv2a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    64051 (Sv2a)
Transporters [BR:mmu02000]
 Major facilitator superfamily (MFS)
  Protein transporters
   Vesicular neurotransmitter transporter (VNT) [TC:2.A.1.22]
    64051 (Sv2a)
SSDB
Motif
Pfam: MFS_1 Sugar_tr Pentapeptide_4 MFS_3 Pentapeptide
Other DBs
NCBI-GeneID: 64051
NCBI-ProteinID: NP_071313
MGI: 1927139
Ensembl: ENSMUSG00000038486
Vega: OTTMUSG00000021899
UniProt: Q9JIS5
Position
3; 3 F2.1
AA seq 742 aa
MEEGFRDRAAFIRGAKDIAKEVKKHAAKKVVKGLDRVQDEYSRRSYSRFEEEDDDDDFPA
PADGYYRGEGAQDEEEGGASSDATEGHDEDDEIYEGEYQGIPRAESGGKGERMADGAPLA
GVRGGLSDGEGPPGGRGEAQRRKDREELAQQYETILRECGHGRFQWTLYFVLGLALMADG
VEVFVVGFVLPSAEKDMCLSDSNKGMLGLIVYLGMMVGAFLWGGLADRLGRRQCLLISLS
VNSVFAFFSSFVQGYGTFLFCRLLSGVGIGGSIPIVFSYFSEFLAQEKRGEHLSWLCMFW
MIGGVYAAAMAWAIIPHYGWSFQMGSAYQFHSWRVFVLVCAFPSVFAIGALTTQPESPRF
FLENGKHDEAWMVLKQVHDTNMRAKGHPERVFSVTHIKTIHQEDELIEIQSDTGTWYQRW
GVRALSLGGQVWGNFLSCFSPEYRRITLMMMGVWFTMSFSYYGLTVWFPDMIRHLQAVDY
AARTKVFPGERVEHVTFNFTLENQIHRGGQYFNDKFIGLRLKSVSFEDSLFEECYFEDVT
SSNTFFRNCTFINTVFYNTDLFEYKFVNSRLVNSTFLHNKEGCPLDVTGTGEGAYMVYFV
SFLGTLAVLPGNIVSALLMDKIGRLRMLAGSSVLSCVSCFFLSFGNSESAMIALLCLFGG
VSIASWNALDVLTVELYPSDKRTTAFGFLNALCKLAAVLGISIFTSFVGITKAAPILFAS
AALALGSSLALKLPETRGQVLQ
NT seq 2229 nt   +upstreamnt  +downstreamnt
atggaagaaggctttcgagaccgagcagcgttcatccgtggggccaaagacattgccaag
gaagtgaagaagcatgcggccaagaaggtggtgaagggccttgacagagtccaggatgag
tattcccgaaggtcctactcccgctttgaggaggaggacgacgacgatgacttccctgcc
cctgcggacggctattaccgcggagaaggggcccaggatgaggaggaaggtggcgcttct
agtgatgccaccgagggccacgatgaagatgatgagatctatgagggagaatatcagggc
atcccccgggcagagtctgggggcaaaggcgaacgcatggcagatggggcacccctggct
ggagtgagagggggcttgagtgatggggagggtccccctgggggtcggggggaggcgcag
cggcgtaaagatcgggaagaattggctcagcagtatgaaaccatcctccgggagtgtggc
catggccgcttccagtggacactctacttcgtgctgggtctggcgctgatggcagatggt
gtagaggtctttgtggtgggctttgtgctgcccagtgctgagaaagacatgtgcctgtcg
gactccaacaaaggcatgctaggcctcattgtgtacctgggcatgatggtgggggccttc
ctctggggaggcctggctgatcggctgggtcggagacagtgtctgctcatctcactctca
gtcaacagcgtcttcgccttcttctcgtccttcgtccagggttatggaacctttctcttc
tgccgcctcctttccggggtcgggattggcggttccatccccatagtcttctcctatttt
tcggagtttctggcgcaggagaaacgtggggagcatttgagctggctctgtatgttctgg
atgatcggtggagtgtatgcagctgcaatggcctgggccatcatccctcactatgggtgg
agtttccagatgggctctgcttaccagttccacagctggagggtgtttgtcctcgtgtgt
gcctttccctctgtgtttgccatcggggctctgactacgcagccagagagtccccgcttc
ttcctagagaatgggaagcatgacgaagcctggatggtactgaagcaggttcacgacacc
aacatgcgagccaagggccaccctgagcgcgtcttctcagtgacccacattaaaacgatt
catcaagaggatgaattgattgagatccagtctgacacaggaacctggtaccagcgctgg
ggagtacgggctttgagccttgggggtcaggtttgggggaatttcctctcctgcttcagt
ccagagtatcggcgcatcacgctgatgatgatgggtgtgtggttcaccatgtctttcagc
tactatggtttgactgtctggtttcccgacatgatccgccatctccaggctgtggactat
gcagcccgaaccaaagtgttcccaggggagcgcgtggagcatgtgacgtttaacttcaca
ctggagaatcagatccaccgagggggacagtacttcaatgacaagttcatcgggctgcgt
ctgaagtcagtgtcctttgaggattccctgtttgaggagtgttactttgaagatgttaca
tccagcaacacattcttccgcaactgcacgttcatcaacactgtgttctataacactgac
ctatttgagtacaagttcgtgaacagccggctggtgaacagcacgttcctgcacaataag
gaaggctgcccgctagacgtgacggggacaggcgaaggtgcctacatggtgtactttgtc
agcttcttggggacactggctgtgcttcctggaaacattgtgtctgctctgctcatggac
aagattggcaggctcagaatgcttgctggttccagtgtgttgtcctgtgtgtcctgcttc
ttcctgtcttttgggaacagcgagtcagccatgatcgctctgctctgcctttttggggga
gttagcatcgcatcctggaacgcgctggacgtgctgaccgttgagctctacccttccgac
aagaggactactgcctttggcttcctgaatgccctgtgtaagctggcagctgtgctgggg
atcagcatcttcacatcctttgtgggcatcaccaaggctgctcccattctctttgcctcg
gctgctcttgcccttggtagctctctggctctgaagctgcctgagacccggggacaggtg
ctgcagtga

KEGG   Mus musculus (mouse): 64176
Entry
64176             CDS       T01002                                 

Gene name
Sv2b, A830038F04Rik, AI850768, mKIAA0735
Definition
(RefSeq) synaptic vesicle glycoprotein 2 b
  KO
K06258  MFS transporter, VNT family, synaptic vesicle glycoprotein 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    64176 (Sv2b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    64176 (Sv2b)
Transporters [BR:mmu02000]
 Major facilitator superfamily (MFS)
  Protein transporters
   Vesicular neurotransmitter transporter (VNT) [TC:2.A.1.22]
    64176 (Sv2b)
SSDB
Motif
Pfam: MFS_1 Sugar_tr Pentapeptide_4 Pentapeptide_3
Other DBs
NCBI-GeneID: 64176
NCBI-ProteinID: NP_001103223
MGI: 1927338
Ensembl: ENSMUSG00000053025
Vega: OTTMUSG00000058388
UniProt: Q8BG39
Position
7; 7 D1
AA seq 683 aa
MDDYRYRDNYEGYAPSDGYYRSNEQNQEEDAQSDVTEGHDEEDEIYEGEYQGIPHPDDVK
SKQTKMAPSRADGLGGQADLMAERMEDEEELAHQYETIIDECGHGRFQWTLFFVLGLALM
ADGVEIFVVSFALPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSM
SLAINASFASLSSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLG
IFWMTGGIYASAMAWSIIPHYGWGFSMGTNYHFHSWRVFVIVCALPATVSMVALKFMPES
PRFLLEMGKHDEAWMILKQVHDTNMRAKGTPEKVFTVSHIKTPKQMDEFIEIQSSTGTWY
QRWLVRFMTIFKQVWDNALYCVMGPYRMNTLILAVVWFTMALSYYGLTVWFPDMIRYFQD
EEYKSKMKVFFGEHVHGATINFTMENQIHQHGKLVNDKFIKMYFKHVLFEDTFFDKCYFE
DVTSTDTYFKNCTIESTTFYNTDLYKHKFINCRFINSTFLEQKEGCHMDFEEDNDFLIYL
VSFLGSLSVLPGNIISALLMDRIGRLKMIGGSMLISAVCCFFLFFGNSESAMIGWQCLFC
GTSIAAWNALDVITVELYPTNQRATAFGILNGLCKFGAILGNTIFASFVGITKVVPILLA
AASLVGGGLIALRLPETREQVLM
NT seq 2052 nt   +upstreamnt  +downstreamnt
atggatgactacaggtatcgggacaactatgagggctatgcccctagtgatggctactac
cgtagcaatgagcagaatcaggaagaagatgcacagagcgatgttacagaaggccatgac
gaggaagatgagatctatgaaggcgagtaccaaggcatccctcatccagatgatgtcaag
tctaagcagaccaagatggcgccctccagagcagatggtcttgggggccaggcagacttg
atggctgagaggatggaagatgaggaggagctggctcaccaatatgagaccatcattgat
gagtgtggccatgggcgcttccagtggaccctcttcttcgtcttgggtttggccttgatg
gctgatggagtggaaatatttgtagtgagctttgctctgccaagtgcagagaaagacatg
tgtctgtccagttccaagaaaggaatgcttgggctgatagtctacctaggaatgatggca
ggggccttcatcttgggcggcctggctgataaactgggaaggaagaaggtcctcagcatg
tcactggccatcaatgcctcctttgcttcactctcctccttcgtgcagggatatggagcc
ttcctcttctgcagactcatctcaggcatagggattgggggctccctgccaattgttttt
gcctacttttctgagttcttatcacgagagaaacgcggtgagcatcttagctggctgggc
atcttctggatgactggaggcatctatgcatctgccatggcctggagcatcattccacac
tatggctggggcttcagcatggggactaattaccacttccacagctggagagtgtttgtc
atcgtctgtgctctgcccgccactgtgtccatggtggctctgaagttcatgccagaaagc
cccaggttcctgctggagatgggcaaacatgatgaagcctggatgattctcaaacaagtc
catgatacaaacatgagagctaaggggaccccggaaaaggtgttcacggtttcccacatc
aaaactcccaagcaaatggatgaattcattgagatacagagctcaaccggaacttggtac
cagcgctggctggtcaggttcatgaccattttcaaacaggtctgggataacgccttgtac
tgtgtgatggggccctacagaatgaacaccctgattctggctgtggtctggttcaccatg
gccttaagttactacggcctgacggtgtggttccccgacatgatccgctatttccaggat
gaagaatataagtctaaaatgaaggtgttttttggtgagcacgtgcatggcgccacgatc
aactttaccatggaaaaccagatccaccaacatgggaagcttgtgaacgataagttcata
aagatgtattttaaacatgtcctctttgaggacacattctttgacaaatgctattttgaa
gatgtgacatccacagatacgtatttcaagaactgcaccatcgaatcgaccaccttctac
aacacagacctctacaaacacaagttcatcaactgtcggtttatcaattccacctttctg
gagcagaaggagggctgccacatggactttgaagaggacaatgattttctgatttacctc
gtcagcttcctcggcagcctctctgtcttgcctgggaacataatttctgccctgctcatg
gacagaattggaagactcaagatgattggcggctccatgctcatctctgcagtctgctgc
ttcttcctgttttttggcaacagcgagtctgcgatgatcggctggcaatgcctgttctgt
gggaccagcattgcagcctggaatgctctggatgtgatcacagttgagctgtatcccacc
aaccagagggccacggccttcggcatcctcaacggactgtgcaagtttggggccatcctg
ggaaacactatctttgcttcttttgttgggataaccaaagtggtccccatccttctggct
gctgcttctctggttggaggtggcctgattgcccttcgattgccagagactcgagagcaa
gtcctgatgtga

KEGG   Mus musculus (mouse): 75209
Entry
75209             CDS       T01002                                 

Gene name
Sv2c, 4930527L09Rik, AI841971
Definition
(RefSeq) synaptic vesicle glycoprotein 2c
  KO
K06258  MFS transporter, VNT family, synaptic vesicle glycoprotein 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    75209 (Sv2c)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    75209 (Sv2c)
Transporters [BR:mmu02000]
 Major facilitator superfamily (MFS)
  Protein transporters
   Vesicular neurotransmitter transporter (VNT) [TC:2.A.1.22]
    75209 (Sv2c)
SSDB
Motif
Pfam: MFS_1 Sugar_tr Pentapeptide_4 Pentapeptide_3
Other DBs
NCBI-GeneID: 75209
NCBI-ProteinID: NP_083486
MGI: 1922459
Ensembl: ENSMUSG00000051111
Vega: OTTMUSG00000035052
UniProt: Q69ZS6
Position
13; 13 D1
AA seq 727 aa
MEDSYKDRTSLMKGAKDIAKEVKKQTVKKVNQAVDRAQDEYTQRSYSRFQDEEDDDDYYP
PGETYSGEVNDDEGSSEATEGHDEEDEIYEGEYQGIPSTNQGKDSIVSVGQPKGDEYKDR
RELESERRADEEELAQQYELIIQECGHGRFQWALFFVLGMALMADGVEVFVVGFVLPSAE
TDLCIPNSGSGWLGSIVYLGMMVGAFFWGGLADKVGRKQSLLICMSVNGFFAFLSSFVQG
YGFFLVCRLLSGFGIGGAIPTVFSYFAEVLAREKRGEHLSWLCMFWMIGGIYASAMAWAI
IPHYGWSFSMGSAYQFHSWRVFVIVCALPCVSSVVALTFMPESPRFLLEVGKHDEAWMIL
KLIHDTNMRARGQPEKVFTVNKIKTPKQIDELIEIESDTGTWYRRCFVRIRTELYGIWLT
FMRCFNYPVRENTIKLTIVWFTLSFGYYGLSVWFPDVIKHLQSDEYALLTRNVQKDKYAN
FSINFTMENQIHTGMEYENGRFLGVKFKSVTFKDSVFKSCTFDDVTSVNTYFKNCTFIDT
LFDNTDFEPYKFIDSEFQNCSFLHNKTGCQITFDDDYSAYWIYFVNFLGTLAVLPGNIVS
ALLMDRIGRLTMLGGSMVLSGISCFFLWFGTSESMMIGMLCLYNGLTISAWNSLDVVTVE
LYPTDRRATGFGFLNALCKAAAVLGNLIFGSLVSITKAIPILLASTVLVCGGLVGLRLPD
TRTQVLM
NT seq 2184 nt   +upstreamnt  +downstreamnt
atggaagactcctacaaggataggacttcactgatgaagggtgccaaggacattgccaaa
gaggtgaagaagcagacggtgaagaaggtgaaccaggcagtggatcgggcccaggatgaa
tatacccagcggtcctacagtcggttccaggatgaagaggacgatgatgactactaccca
cctggcgaaacctacagtggggaggtcaatgatgatgaaggctcaagtgaggccactgag
ggtcacgacgaggaggatgagatctatgaaggggagtaccagggcatccccagcacgaac
caggggaaagacagcatcgtgtctgtaggacagcccaaaggtgatgagtacaaggaccgc
agagagctagagtcagagaggagggctgatgaggaagagctcgcccagcagtatgagctg
ataatccaagagtgtggccacggccgtttccagtgggcccttttcttcgtcctgggcatg
gctctcatggccgatggcgtggaggtgtttgtggtgggcttcgtgctacccagtgcagag
acagacctatgcataccaaattcgggatctggatggctaggtagcatagtgtacctcggg
atgatggtgggggcgttcttctggggaggactggcagacaaagtaggaaggaagcagtct
cttctgatttgcatgtctgtcaacggattctttgccttcctctcctcatttgtccaaggt
tacggcttctttctcgtctgtcggttgctttctggattcgggattggaggcgccattccc
actgtgttctcctacttcgctgaagtcctggcccgggagaagcggggtgagcacctcagt
tggctctgcatgttctggatgattggcggcatctacgcctccgccatggcctgggccatc
attccccactacgggtggagcttcagcatgggttcagcctaccagttccacagctggcgc
gtcttcgtcatcgtctgtgcgctcccgtgcgtctcctctgtggtggctctcaccttcatg
ccagaaagccctcggttcttgctggaggtgggaaaacatgatgaagcctggatgattctg
aagttaattcatgacaccaacatgagagcccggggccagccagagaaggtcttcacggta
aataaaatcaagactcccaaacaaatagatgagctgatcgaaattgagagcgacacggga
acctggtacaggaggtgtttcgttcggatccgcaccgaactgtacggaatttggctgaca
ttcatgagatgcttcaactacccagtcagggaaaacaccatcaagcttacgattgtctgg
ttcaccctgtccttcgggtactatgggttgtccgtttggttccctgatgtcattaaacat
ctccagtctgatgagtatgcactgctaactaggaatgtgcaaaaggataaatatgcaaac
ttcagcattaactttaccatggagaaccagatccacactggaatggaatacgagaacggc
agattcctcggagtcaagttcaaatcggtaaccttcaaagattcagtgtttaagtcctgc
acctttgacgacgtgacctcagtcaacacctacttcaagaactgcacgtttattgatacc
ctttttgataacacagattttgagccctataaattcatagacagtgaatttcagaactgc
tcatttcttcacaataagacggggtgccagattacttttgatgacgactatagtgcctac
tggatttactttgtcaactttcttgggacattggcagtgttgccaggaaatatcgtgtct
gctctcctgatggacaggatcgggcgtttaacgatgctaggaggctccatggtgctctcc
gggatcagttgcttcttcctgtggtttggcaccagcgaatccatgatgataggcatgctg
tgcttgtataatgggctgaccatctcagcgtggaattctctcgatgtcgtcacggtggaa
ctgtatcccacagaccggagagcaacgggcttcggcttcttgaacgccctctgtaaagcg
gcggccgtcctgggaaacttaatcttcggctccttggtcagcatcaccaaagccatcccc
atcctgctggcttccactgtgctcgtgtgtggaggactcgtggggctgcgcctgcccgac
acacgaacccaggttctgatgtga

DBGET integrated database retrieval system