KEGG   Mus musculus (mouse): 64085Help
Entry
64085             CDS       T01002                                 

Gene name
Clstn2, 2900042C18Rik, AI448973, CSTN2, Cs2, Cst-2, mKIAA4134
Definition
(RefSeq) calsyntenin 2
  KO
K22660  calsyntenin 2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mmu04515]
    64085 (Clstn2)
Cell adhesion molecules [BR:mmu04515]
 Cadherins
  Cadherin related
   64085 (Clstn2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cadherin Laminin_G_3
Motif
Other DBs
NCBI-GeneID: 64085
NCBI-ProteinID: NP_071714
MGI: 1929897
Ensembl: ENSMUSG00000032452
Vega: OTTMUSG00000032788
UniProt: Q9ER65
Position
9; 9 E3.3
AA seq 966 aa AA seqDB search
MLPGRLCLVPLLLALGVGSGGGSGDGGDSRRRRLLVAKVNKHKPWIETSYHGVITENNDT
VILDPPLVALDKDAPVPFAGEICAFKIHGQELPFEAVVLNKTSGEGRLRAKSPIDCELQK
EYTFIIQAYDCGAGPREAAWKKSHKAVVHIQVKDVNEFAPTFKEPAYKAIVTEGKIYDSI
LQVEAIDEDCSPQYSQICNYEIVTTDVPFAIDRNGNIRNTEKLSYDKQHQYEILVTAYDC
GQKPAAQDTLVQVDVKPVCKPGWQDWTKRIEYQPGSGSMPLFPSIHLETCDGAVSSLQVT
AELQTNYIGKGCDRETYSEKSLQKLCGASSGIIDLLPSPSAATNWTAGLLVDSSEMIFKF
DGRQGAKIPDGIVPKNLTDQFTITMWMKHGPSPGVRAEKETILCNSDKTEMNRHHYALYV
HNCRLVFLLRKDFDQADTFRPAEFHWKLDQICDKEWHYYVINVEFPVVTLYMDGATYEPY
LVTNDWPIHPSHIAMQLTVGACWQGGEVAKPRFAQFFHGSLASLTIRPGKMESQKVISCL
QACKEGLDINSLESLGRGIKYHFNPSQSILVMEGDDIGNINRALQKVSYINSRQFPTAGV
RRLRLSSKVQCFGEDVCISIPDVDAYIMVLQAIEPQITLQGTERFWRPAAQFESARGVTL
FPDIKIVSTFAKTEASGDMRATGTAPKSAVLEEMLHNLDFCDILVLGGDLDPRQECLELN
HSELHQRHLDATNSTAGYSIYGVGSMNRYEQVLHHLRYRNWHPTSLETRRFRIKCSELNG
RYTSNEFNLEVSVLHEVRVSDKEHVNHLIVQPPFLQSVHHPETRSSIQRSSVVPSIATVV
IIISVCMLVFVVAMGVYRVRIAHQHFIQETEAAKEAEMDWDDSALTITVNPMEKHEGPGN
GEDETTEVEEEEEAEEGSSSSSSGSDDSEEEEEEGMGRVRHGQSGTSSQSPERSTWNTAG
VINIWK
NT seq 2901 nt NT seq  +upstreamnt  +downstreamnt
atgctgccggggaggctgtgcttggtgccgctcctgctggcgctgggcgtagggagcggc
ggcggcagtggagacggcggagacagccggcggcgccgcctcctcgtggcgaaagtcaat
aaacacaagccatggatcgagacatcgtatcacggagtcataactgagaacaatgacaca
gtcatcttggaccctccactggttgccctggataaagatgccccagtgccttttgcaggg
gaaatctgtgcattcaagatccatggacaggagctgccctttgaggctgtggtgctcaat
aagacatctggagagggccggctccgcgccaagagtcccatcgactgtgagctgcagaag
gagtacacgttcatcatccaggcctatgactgtggtgcggggcctcgggaagcagcctgg
aagaagtcacacaaggctgtggtccacatccaggtgaaggatgtcaatgagtttgcaccc
accttcaaagagccagcctacaaggccatcgtcacggagggcaagatctatgacagcatc
ctgcaggtagaagccattgatgaggactgctccccgcagtacagccagatttgcaactat
gaaattgtcacaacggatgtgccttttgccattgacagaaatggcaacatcaggaacact
gagaagctgagctatgacaagcaacaccagtatgagatcctggtaaccgcttatgactgt
ggacagaaacccgccgctcaggacaccctggtgcaggtggacgtgaaaccagtgtgcaag
cccggctggcaagattggaccaaaaggattgagtaccagcctggctcggggagtatgccc
ttgttccccagcatccacctggagacatgcgatggagctgtgtcctccctccaggtcact
gcggagctgcagactaattacatcggcaagggctgtgaccgagagacctactctgagaaa
tcccttcagaaattatgtggcgcatcctcgggtatcatcgatctcttgccgtcccctagc
gcagctaccaactggactgcggggctgctggtggacagcagtgagatgatcttcaagttt
gacggcaggcagggtgccaagatccctgatgggatcgtgcccaagaacctgacggaccag
ttcaccatcaccatgtggatgaaacatggccccagccccggcgtgagagccgagaaggaa
actatcctctgtaactcagataaaactgaaatgaaccggcatcactatgccctgtatgtg
cacaactgccgcctcgtcttcctcctgcggaaggactttgaccaggcagacacctttcgc
cctgcagagtttcactggaagctggaccagatttgtgacaaagagtggcattactatgtc
atcaatgtggagttccctgtggttaccctgtacatggatggagcaacatatgaaccatac
ctggtgactaatgactggcccattcatccatctcacatagccatgcaacttactgtcggc
gcctgttggcaaggaggcgaagtggccaaaccacggtttgcacaatttttccatggcagc
cttgccagtctcacaatccgtcctggcaaaatggaaagccagaaggtgatttcttgtttg
caggcctgcaaagaagggctggatattaattccttggaaagccttgggcgagggataaag
tatcacttcaacccttcacagtccatcctcgtgatggaaggcgatgacattgggaacatc
aaccgagccctccagaaagtctcctatatcaactcccggcaattcccaacagcaggggtc
cggcgcctcagactctcttccaaagtccagtgctttggagaagatgtgtgcatcagcatc
ccagatgtggatgcctacatcatggtcttacaggccattgagccccagatcaccctccag
ggaacagagcgtttctggagacctgctgcccagtttgaaagtgccagaggagtgactctc
ttccctgacatcaagattgtgagcacctttgccaagactgaggcctccggggacatgaga
gccacaggtacagcccccaaatcagcagtcttggaagaaatgctacacaatttggatttc
tgtgacattttggtgcttggaggggacttggatccaaggcaagagtgcttggagctcaac
cacagtgagctccaccaacgacaccttgatgccaccaactcaactgctggctactccatc
tatggtgtgggctccatgaaccgctatgagcaggtgctgcatcacctccgttaccgcaac
tggcaccccacgtcccttgagacccggaggttccggatcaagtgctcagaactcaacggg
cgttacactagcaatgagttcaacttggaggtcagtgtcctccatgaagtgagagtctct
gacaaggaacatgtcaaccaccttattgtgcagccaccctttctccagtctgtccatcac
cctgagacccggagtagtatccagcgcagttcagtggtcccgagcatcgccactgtcgtc
atcattatctctgtgtgcatgctagtgtttgttgtggccatgggtgtgtaccgagtccga
attgcccaccagcattttatccaagagactgaggctgccaaggaagctgagatggactgg
gatgactctgcactgactatcactgtcaaccctatggagaaacatgaaggcccagggaac
ggggaagatgaaaccaccgaagtagaggaagaggaggaagcagaggaaggctcgagctcc
agcagcagtggttccgatgacagcgaagaggaagaagaggaagggatgggcagagtcaga
catgggcagagcggcaccagctctcaaagccctgaaagaagtacctggaacactgcagga
gtcataaacatttggaagtga

DBGET integrated database retrieval system