KEGG   Mus musculus (mouse): 64103
Entry
64103             CDS       T01002                                 

Gene name
Tnmd, 1110017I01Rik, Bricd4, ChM1L, TeM
Definition
(RefSeq) tenomodulin
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: BRICHOS RIB43A
Other DBs
NCBI-GeneID: 64103
NCBI-ProteinID: NP_071717
MGI: 1929885
Ensembl: ENSMUSG00000031250
Vega: OTTMUSG00000018674
UniProt: Q9EP64
Position
X; X E3
AA seq 317 aa
MAKNPPENCEGCHILNAEALKSKKICKSLKICGLVFGILALTLIVLFWGSKHFWPEVSKK
TYDMEHTFYSNGEKKKIYMEIDPITRTEIFRSGNGTDETLEVHDFKNGYTGIYFVGLQKC
FIKTQIKVIPEFSEPEEEIDENEEITTTFFEQSVIWVPAEKPIENRDFLKNSKILEICDN
VTMYWINPTLIAVSELQDFEEDGEDLHFPTSEKKGIDQNEQWVVPQVKVEKTRHTRQASE
EDLPINDYTENGIEFDPMLDERGYCCIYCRRGNRYCRRVCEPLLGYYPYPYCYQGGRVIC
RVIMPCNWWVARMLGRV
NT seq 954 nt   +upstreamnt  +downstreamnt
atggcaaagaatcctccagagaactgtgagggctgtcacattctaaatgcagaagctctg
aaatctaagaagatatgtaaatcactgaagatttgtggactagtgtttggtatcctggcc
ttaactctaattgtcctgttttgggggagcaaacacttctggcccgaggtatccaagaaa
acctatgacatggagcacactttctacagcaacggcgagaagaagaagatttacatggaa
attgatcccataaccagaacagaaatattcagaagtggaaatggcactgatgaaacattg
gaagtccatgactttaaaaatggatacactggcatctactttgtaggtcttcaaaaatgc
tttattaaaactcaaatcaaagtgattcctgaattttctgaaccagaggaagaaatagat
gagaatgaagaaattactacaactttctttgaacagtcagtgatttgggttcccgcagaa
aagcctattgaaaacagagacttcctgaaaaattctaaaattctggagatttgcgataat
gtgaccatgtactggatcaatcccactctaatagcagtttcagaattacaggactttgag
gaggacggtgaagatcttcactttcctaccagtgaaaaaaaggggattgaccagaatgag
caatgggtggtcccgcaagtgaaggtggagaagacccgccacaccagacaagcaagcgag
gaagaccttcctataaatgactatactgaaaatggaattgaatttgacccaatgctggat
gagagaggttactgttgtatttactgtcgtcgaggcaaccgttactgccgccgtgtctgt
gaacctttactaggctactacccatacccctactgctaccaaggaggtcgagtcatctgt
cgtgtcatcatgccttgcaactggtgggtggcccgcatgcttgggagagtctaa

DBGET integrated database retrieval system