KEGG   Mus musculus (mouse): 64113
Entry
64113             CDS       T01002                                 

Gene name
Moap1, AA987038, MAP, Map-1, PN, Pnma4
Definition
(RefSeq) modulator of apoptosis 1
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: PNMA
Other DBs
NCBI-GeneID: 64113
NCBI-ProteinID: NP_001136409
MGI: 1915555
Ensembl: ENSMUSG00000096458
Vega: OTTMUSG00000037134
UniProt: Q9ERH6
Position
12; 12 E
AA seq 352 aa
MTLRLLEDWCRGMDMNPRKALLVAGIPPTCGVADIEEALQAGLAPLGEHRLLGRMFRRDE
NKNVALIGLTVETGSALVPKEIPAKGGVWRVIFKPPDTDSDFLCRLNEFLKGEGMTMGEL
TRVLGNRNDPLGLDPGIMIPEIRAPMLAQALNEALKPTLQYLRYKKLSVFSGRDPPGPGE
EEFESWMFHTSQVMKTWQVSDVEKRRRLIESLRGPAFEIIRVLKINNPFITVAECLKTLE
TIFGIIDNPRALQVKYLTTYQKTDEKLSAYVLRLEPLLQKLVQKGAIEKEVVNQARLDQV
IAGAVHKSVRRELGLPEGSPAPGLLQLLTLIKDKEAEEEEVLLQAELEGYCT
NT seq 1059 nt   +upstreamnt  +downstreamnt
atgacactgagacttctagaagactggtgcagagggatggatatgaatcctcggaaagca
ctattggttgccggcatccctccgacctgcggagtggcagacatagaggaggccctgcag
gctggccttgctcccttaggggaacacagactgcttgggaggatgttcaggagggatgag
aacaagaatgtagccctgattgggcttacagtagagactggcagtgccctggtccccaag
gaaatacctgcaaaaggaggtgtctggagagtgatctttaagcctcctgatactgatagt
gactttttgtgcagattaaatgagtttttaaagggggagggcatgacgatgggtgaatta
accagagttcttgggaatcggaatgaccctctcggcctagacccgggcataatgatccct
gaaattcgagcacccatgttagcacaggcattaaatgaggcccttaagcctaccctgcag
tatctgaggtacaaaaagctgagtgtgttctcaggcagggatcctccaggaccaggtgag
gaagaatttgaatcttggatgtttcatacttcccaagtaatgaaaacatggcaggtgtca
gatgtagagaaaagaaggcggttgatagagagccttagaggtccagcatttgaaattatt
cgagtcctcaagataaacaaccccttcattacagttgcagaatgcctgaagacgcttgag
acaatatttgggattattgataatcctagagcattgcaggtcaaataccttactacttat
cagaagactgatgaaaagctgtctgcctatgttctaaggttggagcctttattgcagaaa
ctggttcagaaaggagcaattgagaaagaagttgtgaatcaggcccgtctagaccaagtc
attgctggggcagtccacaaatcagttcgaagagagcttgggctgccggagggtagccca
gccccaggcttactgcagttgctgacactgataaaagataaggaggccgaagaagaagag
gtcctccttcaggccgaattagaaggctattgcacttga

DBGET integrated database retrieval system