KEGG   Mus musculus (mouse): 641340
Entry
641340            CDS       T01002                                 

Gene name
Nrbf2, NRBF-2
Definition
(RefSeq) nuclear receptor binding factor 2
  KO
K21246  nuclear receptor-binding factor 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04140  Autophagy - animal
mmu05010  Alzheimer disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    641340 (Nrbf2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    641340 (Nrbf2)
   05014 Amyotrophic lateral sclerosis
    641340 (Nrbf2)
   05016 Huntington disease
    641340 (Nrbf2)
   05017 Spinocerebellar ataxia
    641340 (Nrbf2)
   05022 Pathways of neurodegeneration - multiple diseases
    641340 (Nrbf2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    641340 (Nrbf2)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Autophagosome formation proteins
   PI3K complex
    641340 (Nrbf2)
SSDB
Motif
Pfam: NRBF2 NRBF2_MIT MIT bZIP_1 DivIC YabA HALZ DUF5101 TPR_7
Other DBs
NCBI-GeneID: 641340
NCBI-ProteinID: NP_001031370
MGI: 1354950
Ensembl: ENSMUSG00000075000
Vega: OTTMUSG00000028050
UniProt: Q8VCQ3
Structure
PDB: 
2CRB

Position
10; 10 B5.1
AA seq 287 aa
MEVMEGPLNLAHQQSRRADRLLAAGKYEEAISCHRKATTYLSEAMKLTESEQAHLSLELQ
RDSHMKQLLLIQERWKRAKREERLKAQQSTERDGAPHLQAPPRPSEDAEGQSPLLSQPYI
PSTERRLPEVQGVFDRDPDTLLFLLQQKNEPSEPCIGSKAPKDDKTIIEEQATKIADLKR
HVEFLVAENERLRKENKQLKAEKARLLKGTAEKELDVDADFVEKSELWGLPSHSESAAAS
STWQKFAANTGKAKDIPIPNLPPLDFPSPELPLMELSEDILKGFMND
NT seq 864 nt   +upstreamnt  +downstreamnt
atggaagtgatggaaggacccctcaaccttgctcaccagcagagccgccgagcagaccgt
ttgttagctgctgggaaatacgaagaggcgatttcttgtcacagaaaggcaacaacatat
ctctctgaagccatgaagctgaccgagtctgagcaggctcacttatcactggaactgcaa
agggacagccacatgaaacagctgcttctcatccaggagaggtggaagagagcaaagcga
gaggagcggttgaaagcgcagcagagcacggaacgggacggagccccccacctgcaggca
cctcccaggccctctgaggatgctgaaggccagagccctctgctttctcagccatacatc
ccttccacagagaggcgcctccccgaggtgcagggggtctttgacagggatccagacaca
ttgctgtttttacttcagcaaaagaatgagccatcagagccctgtattggaagcaaagcc
ccaaaagatgataaaacgattatagaggagcaggcaaccaaaatagcagatttgaagagg
catgtggagttccttgtggctgagaatgaaagattaaggaaagaaaataaacagctaaag
gctgaaaaggccagactcctgaaaggcacagctgagaaggaactggacgtcgatgcagac
tttgtagagaagtcagagctgtggggcttaccttcacactcggaatccgccgctgcctct
tcaacctggcagaagtttgcagctaacacggggaaagccaaggacattccaatacccaac
cttcctcctctggatttcccatctccagagcttcctctgatggagctctcggaggacatt
ctgaaaggattcatgaatgactaa

DBGET integrated database retrieval system