KEGG   Mus musculus (mouse): 64209
Entry
64209             CDS       T01002                                 

Gene name
Herpud1, He, Herp, Mi, Mifl, SUP
Definition
(RefSeq) homocysteine-inducible, endoplasmic reticulum stress-inducible, ubiquitin-like domain member 1
  KO
K14027  homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    64209 (Herpud1)
SSDB
Motif
Pfam: ubiquitin DUF2407 Rad60-SLD_2
Other DBs
NCBI-GeneID: 64209
NCBI-ProteinID: NP_071726
MGI: 1927406
Ensembl: ENSMUSG00000031770
Vega: OTTMUSG00000027364
UniProt: Q9JJK5 Q3TMN9
Position
8; 8 C5
AA seq 391 aa
MEPEPQPEPVTLLVKSPNQRHRDLELSGDRSWSVSRLKAHLSRVYPERPRPEDQRLIYSG
KLLLDHQCLQDLLPKQEKRHVLHLVCNVKNPSKMPETSTKGAESTEQPDNSNQTQHPGDS
SSDGLRQREVLRNLSPSGWENISRPEAVQQTFQGLGPGFSGYTTYGWLQLSWFQQIYARQ
YYMQYLAATAASGTFVPTPSAQEIPVVSTPAPAPIHNQFPAENQPANQNAAAQAVVNPGA
NQNLRMNAQGGPLVEEDDEINRDWLDWTYSAATFSVFLSILYFYSSLSRFLMVMGATVVM
YLHHVGWFPFRQRPVQNFPDDGGPRDAANQDPNNNLQGGMDPEMEDPNRLPPDREVLDPE
HTSPSFMSTAWLVFKTFFASLLPEGPPALAN
NT seq 1176 nt   +upstreamnt  +downstreamnt
atggagcccgagccacagcccgagccggtcacgctgctggtgaagagtcccaatcagcgc
caccgcgacttggagctgagtggcgaccgcagttggagtgtgagtcgcctcaaggcccac
ctgagccgagtctaccccgagcgcccgcgtccagaggaccagaggttaatttattctggg
aagctgctgttggatcaccagtgtctccaagatttgcttccaaagcaggaaaagcgacat
gttttgcaccttgtgtgcaatgtgaagaatccctccaaaatgccagaaaccagcacaaag
ggtgctgaatccacagagcagccggacaactctaatcagacacagcatcctggggactcc
tcaagtgatggtttacggcaaagagaagttcttcggaacctttctccctccggatgggag
aacatctctaggcctgaggctgtccagcagactttccaaggcctggggcctggcttctct
ggctacacaacgtatgggtggctgcagctctcctggttccagcagatctatgcaaggcag
tactacatgcaatacttagctgccactgctgcatcaggaacttttgtcccgacaccaagt
gcacaagagatacctgtggtctctacacctgctccggctcctatacacaaccagtttccg
gcagaaaaccagccggccaatcagaatgcagctgctcaagcggttgtcaatcccggagcc
aatcagaacttgcggatgaatgcacaaggtggccccctggtggaggaagatgatgagata
aaccgagactggttggattggacctattccgcagcgacgttttctgttttcctcagcatc
ctttacttctactcctcgctgagcagatttctcatggtcatgggtgccactgtagtcatg
tacctgcaccacgtcgggtggtttccgttcagacagaggccagttcagaacttcccggat
gatggtggtcctcgagatgctgccaaccaggaccccaacaataacctccagggaggtatg
gacccagaaatggaagaccccaaccgcctccccccagaccgcgaagtgctggaccctgag
cacaccagcccctcgtttatgagcacagcatggctagtcttcaagactttctttgcctct
cttcttccagaaggcccaccagccctagccaactga

DBGET integrated database retrieval system