KEGG   Mus musculus (mouse): 64242Help
Entry
64242             CDS       T01002                                 

Gene name
Ngb
Definition
(RefSeq) neuroglobin
  KO
K21893  neuroglobin
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    64242 (Ngb)
Transporters [BR:mmu02000]
 Other Transporters
  Pores ion channels [TC:1]
   64242 (Ngb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Globin
Motif
Other DBs
NCBI-GeneID: 64242
NCBI-ProteinID: NP_071859
MGI: 2151886
Ensembl: ENSMUSG00000021032
Vega: OTTMUSG00000020165
UniProt: Q9ER97 Q5ZPR7
Structure
PDB: 

Position
12; 12 D2
AA seq 151 aa AA seqDB search
MERPESELIRQSWRVVSRSPLEHGTVLFARLFALEPSLLPLFQYNGRQFSSPEDCLSSPE
FLDHIRKVMLVIDAAVTNVEDLSSLEEYLTSLGRKHRAVGVRLSSFSTVGESLLYMLEKC
LGPDFTPATRTAWSRLYGAVVQAMSRGWDGE
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atggagcgcccggagtcagagctgatccggcagagctggcgggtagtgagccgcagccct
ctggaacatggcactgtcctgttcgccaggctcttcgccctggaacccagcctgctgcct
ctcttccagtacaatggccgccagttctccagccctgaggactgtctctcctctccagaa
ttcctggaccacattaggaaggtgatgctagtgattgatgctgcagtgaccaacgtggag
gacctgtcttcattggaggagtacctgaccagcttgggcaggaagcatcgggcagtggga
gtgaggctcagctccttctcgacagtaggcgagtccctgctctacatgctggagaagtgc
ctgggtcccgactttacaccagctacaaggaccgcctggagccgactctacggagctgtg
gtgcaagccatgagccgaggctgggatggggagtaa

DBGET integrated database retrieval system