KEGG   Mus musculus (mouse): 64294Help
Entry
64294             CDS       T01002                                 

Gene name
Itm2c, 3110038L02Rik, BRI3, Bricd2c, E25, E25C, ITM3
Definition
(RefSeq) integral membrane protein 2C
  KO
K18265  integral membrane protein 2C
Organism
mmu  Mus musculus (mouse)
Brite
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   64294 (Itm2c)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BRICHOS
Motif
Other DBs
NCBI-GeneID: 64294
NCBI-ProteinID: NP_071862
MGI: 1927594
Ensembl: ENSMUSG00000026223
Vega: OTTMUSG00000029979
UniProt: Q91VK4
Position
1; 1 C5
AA seq 269 aa AA seqDB search
MVKISFQPAVAGIKADKADKAAASGPASASAPAAEILLTPAREERPPRHRSRKGGSVGGV
CYLSMGMVVLLMGLVFASVYIYRYFFLAQLARDNFFHCGVLYEDSLSSQIRTRLELEEDV
KIYLEENYERINVPVPQFGGGDPADIIHDFQRGLTAYHDISLDKCYVIELNTTIVLPPRN
FWELLMNVKRGTYLPQTYIIQEEMVVTEHVRDKEALGSFIYHLCNGKDTYRLRRRSTRRR
INKRGGKNCNAIRHFENTFVVETLICGVV
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagatcagtttccagcccgcggtagcgggcatcaaggctgataaagcggacaaa
gcagcggcgtctggtccggcctcggcatctgccccggccgcggagatcctgctgacgccg
gcgagggaggaacgcccccctcgccaccgctcccggaaaggaggctccgtgggcggcgtg
tgctacctgtccatgggcatggttgtattgctcatgggccttgtgtttgcctcggtctac
atctacaggtacttcttccttgctcagctggcccgagataacttcttccactgtggtgtg
ctctacgaagactccctgtcctcccagatccggactcgcctggagctggaagaggatgtg
aagatctatcttgaggagaactatgaacgtattaatgtccctgtgccccagtttggtggt
ggggaccctgcagacatcatccatgacttccagcggggtctcactgcctaccacgacatc
tccctagacaagtgctacgtcatcgagctcaacaccaccatcgtgctacccccacgaaac
ttctgggagctcctcatgaacgtgaagagagggacctacctcccacagacgtacatcatc
caggaggagatggtggtgacagagcatgtccgcgacaaggaggctctgggttccttcatc
taccacctgtgcaacgggaaggacacctaccggctgcggcgccggtctacccggaggcgg
atcaacaaacgtgggggcaagaactgcaacgccatccgccacttcgagaatacatttgtg
gtggagacgctcatctgtggggtggtgtga

DBGET integrated database retrieval system