KEGG   Mus musculus (mouse): 64297
Entry
64297             CDS       T01002                                 

Gene name
Gprc5b, AW125761, Raig2
Definition
(RefSeq) G protein-coupled receptor, family C, group 5, member B
  KO
K04619  G protein-coupled receptor family C group 5 member B
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    64297 (Gprc5b)
   04030 G protein-coupled receptors [BR:mmu04030]
    64297 (Gprc5b)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   64297 (Gprc5b)
G protein-coupled receptors [BR:mmu04030]
 Metabotropic glutamate receptor family
  Orphan GPRC5
   64297 (Gprc5b)
SSDB
Motif
Pfam: 7tm_3
Other DBs
NCBI-GeneID: 64297
NCBI-ProteinID: NP_071865
MGI: 1927596
Ensembl: ENSMUSG00000008734
Vega: OTTMUSG00000059047
UniProt: Q923Z0
Position
7; 7 F2
AA seq 410 aa
MFLVLERKMRTHQVFPLPLLLVIASVASENASTSRGCGLDLLPQYVSLCDLDAIWGIVVE
AVAGAGALITLLLMLILLVRLPFIKDKERKRPVCLHFLFLLGTLGLFGLTFAFIIQMDET
ICSIRRFLWGVLFALCFSCLLSQAWRVRRLVRQGTSPASWQLVSLALCLMLVQVIIATEW
LVLTVLRDTKPACAYEPMDFVMALIYDMVLLAITLAQSLFTLCGKFKRWKVNGAFILVTT
FLSALIWVVWMTMYLFGNSLIKQGDAWSDPTLAITLAASGWVFVIFHAIPEIHYTLLPPL
QENPPNYFDTSQPRMRETAFDEEMHLPRAYMENKAFSMDEHNAALRSAVGFSNGSLEQRS
SSLGKKPSSLGNRPSAPFRSNVYQPTEMAVVLNGGTIPTAPPSHTGRHHW
NT seq 1233 nt   +upstreamnt  +downstreamnt
atgttcctggtgttagagagaaagatgagaacccatcaagtgtttcccttgcccctgctc
ctggtgattgcctccgtggcttcagagaacgccagcacgtcccggggctgtggactggac
cttcttcctcagtacgtgtccctgtgcgacctggacgccatctggggcatcgtggtggag
gcagtggccggggcgggggccctgatcacactgcttctgatgctcattctcctagtgaga
ctacccttcatcaaggacaaggaaaggaagcggcctgtgtgcctccatttcctcttcctg
ctggggaccctgggcctctttggcctgacgtttgccttcatcatccagatggacgagaca
atctgctccatccgacgcttcctctggggtgtcctcttcgcgctctgcttttcctgcctg
ctgagccaggcgtggcgggtgcggaggctggtgcgccagggcacaagcccggccagctgg
cagctggtgagcctggcactgtgcctgatgctggtgcaggtcatcattgccactgagtgg
ctggtgctgactgtgctgcgtgacacgaagccagcctgcgcctacgagcccatggatttt
gtgatggcgctcatctacgacatggtgctgctggccatcaccctggcccagtccctcttc
acgctgtgtggcaagttcaaacggtggaaggtgaacggagccttcatcctcgtcactacc
ttcctctctgcgctcatctgggtggtctggatgaccatgtacctcttcggcaactcatta
attaagcagggagatgcctggagcgaccccaccttggccattacactggcagccagcgga
tgggtctttgtcatcttccatgccattccggagatccactacacccttctcccacccctg
caggagaacccacccaactacttcgacacttcacagcccaggatgcgggagacagcattt
gatgaggaaatgcacctgcctcgggcctacatggagaacaaggccttctcaatggatgaa
cataacgcagctctccgatcagcagtgggcttttccaatggaagcttggagcaaagatct
agcagcctgggaaagaagcccagcagcttgggaaaccggcccagtgcaccgttcagaagc
aatgtgtatcagccgaccgagatggccgtcgtgctcaatggagggactatcccaactgct
ccgccatctcacacgggaagacaccattggtga

DBGET integrated database retrieval system