KEGG   Mus musculus (mouse): 64340
Entry
64340             CDS       T01002                                 

Gene name
Dhx38, 5730550P09Rik, AI325984, AW540902, Ddx38, KIAA0224, Prp16
Definition
(RefSeq) DEAH (Asp-Glu-Ala-His) box polypeptide 38
  KO
K12815  pre-mRNA-splicing factor ATP-dependent RNA helicase DHX38/PRP16 [EC:3.6.4.13]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    64340 (Dhx38)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    64340 (Dhx38)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     64340 (Dhx38)
Spliceosome [BR:mmu03041]
 Complex C
  Other components
   Step II factors
    64340 (Dhx38)
SSDB
Motif
Pfam: HA2 OB_NTP_bind Helicase_C DEAD AAA_22 AAA_30 AAA_19 T2SSE PhoH AAA_33 Flavi_DEAD Microtub_bd AAA_7
Other DBs
NCBI-GeneID: 64340
NCBI-ProteinID: NP_848467
MGI: 1927617
Ensembl: ENSMUSG00000037993
Vega: OTTMUSG00000061917
UniProt: Q80X98
Position
8; 8 D3
AA seq 1228 aa
MEDPGEDTSIHRLEGTSLDSQVGGLICKTKSAANEQHVFKAPAPRPSLLGLDLLASLKRR
EREEKDDGEDKKKSRVSSYKDWEESKDDQKDAEEESEDQAGRSSRRDRHYRSARVETPSH
PGGVSEEFWERSRQRERDRREHGVYASSKEEKDRKKERSRDRDYDRKRDRADERDRSRHS
SRSDRDGGSERSSRRNEPESPRHRPKDAATPSRSAWEEDDSGYGSSRRSQWETPSPTPSY
RDSERGHRPSTRDRDRSIRSKSSDDTPLPTPSYKYNEWADDRRHLGSTPRLSRGRGRRED
GEEGIAFDTEEERQQWEDDQRQADRDWYMMDEGYDEFHNPLAYSSEDYVRRREQHLHKQK
QKRISAQRRQINEDNERWETNRMLTSGVVHRLEVDEDFEEDNAAKVHLMVHNLVPPFLDG
RIVFTKQPEPVIPVKDATSDLAIIARKGSQTVRKHREQKERRKAQHKHWELAGTKLGDIM
GVKKEEEPDKAMTEDGKVDYRTEQKFADHMKEKSEASSEFAKKKSILEQRQYLPIFAVQQ
ELLTIIRDNSIVIVVGETGSGKTTQLTQYLHEDGYTDYGMIGCTQPRRVAAMSVAKRVSE
EMGGNLGEEVGYAIRFEDCTSENTLIKYMTDGILLRESLREADLDHYSAVIMDEAHERSL
NTDVLFGLLREVVARRSDLKLIVTSATMDAEKFAAFFGNVPIFHIPGRTFPVDILFSKTP
QEDYVEAAVKQSLQVHLSGAPGDILIFMPGQEDIEVTSDQIVEHLEELENAPALAVLPIY
SQLPSDLQAKIFQKAPDGVRKCIVATNIAETSLTVDGIMFVIDSGYCKLKVFNPRIGMDA
LQIYPISQANANQRSGRAGRTGPGQCFRLYTQSAYKNELLTTTVPEIQRTNLANVVLLLK
SLGVQDLLQFHFMDPPPEDNMLNSMYQLWILGALDNTGGLTSTGRLMVEFPLDPALSKML
IVSCDMGCSSEILLIVSMLSVPAIFYRPKGREEESDQIREKFAVPESDHLTYLNVYLQWK
NNNYSTIWCNDHFIHAKAMRKVREVRAQLKDIMVQQRMSLASCGTDWDIVRKCICAAYFH
QAAKLKGIGEYVNIRTGMPCHLHPTSSLFGMGYTPDYIVYHELVMTTKEYMQCVTAVDGE
WLAELGPMFYSVKQAGKSRQENRRRAKEEASAMEEEMALAEEQLRARRQEQEKRSPLGSV
RSTKIYTPGRKEQGEPMTPRRTPARFGL
NT seq 3687 nt   +upstreamnt  +downstreamnt
atggaggaccctggtgaggatacctccatccatcgcttggaaggcaccagtttggactct
caggttggtggtcttatttgcaagaccaaaagtgcagccaatgagcagcatgtcttcaaa
gcccctgctccccgcccttcactgctggggctggacttactggcgtccctgaaacggagg
gagcgagaggagaaggatgatggggaggacaagaaaaagtccagagtctcttcttacaaa
gactgggaggagagtaaggatgaccagaaggatgccgaggaggagagcgaggaccaggct
ggccgaagtagccggagagacaggcattaccgatctgctcgggtagagactccgtcccac
cccgggggtgtgagtgaagagttttgggaacgcagtaggcagagagagcgggatcggagg
gagcacggggtctatgcctcatctaaagaagaaaaggatcggaagaaggagagatcccgg
gatcgagactatgaccgcaagagagacagagcagatgagcgggacagaagtaggcacagc
agcagatcagaccgagacggaggctccgagcgcagcagcagaagaaatgaacctgagagt
cctcgacatcggcccaaagatgcagccaccccttcgaggtccgcctgggaggaggacgac
agtggctatggctcttcaaggcgctctcagtgggaaacaccctccccaacaccttcctat
cgggactctgagcgaggtcatcggccgtccactcgggatcgagacaggtctataaggagc
aagtcttcagatgacacacctctgccgaccccctcctataagtacaatgaatgggctgat
gatagaagacacttggggtctaccccacgtctgtccaggggccgaggcagacgtgaggat
ggcgaagaagggattgcgtttgacacagaggaggagcggcagcagtgggaggatgaccag
aggcaagcagaccgggactggtacatgatggatgagggctacgatgagttccacaaccct
ctggcctactcgtctgaggactacgtgaggcggcgggagcagcacctgcacaaacagaag
cagaagcgcatttcagcgcagcgcaggcaaatcaacgaggacaatgagcgctgggagaca
aaccgaatgctcaccagtggggtggtccatcggctggaggtggacgaggactttgaagag
gacaatgcggccaaggtgcatctgatggtgcacaacctggtgcctccctttctggatggg
cgcatcgttttcaccaagcagccggagcctgtgatcccagtgaaggatgccacctctgac
ctggccattattgctcggaaaggcagccagacggtccgcaagcacagggaacagaaagaa
cggagaaaggctcagcacaaacactgggaactggcagggaccaaactaggagacataatg
ggtgtcaaaaaagaagaggagccggataaagctatgacagaagacgggaaagtggactac
aggacggagcagaagtttgcagatcacatgaaggagaaaagcgaggccagcagtgagttt
gccaagaagaagtcgatcctggagcagaggcagtacctgcccatctttgccgtgcagcag
gagctgctcaccatcatcagagacaacagcattgtgatcgtggtcggggagacagggagt
ggcaagaccactcagctgacccagtacttgcatgaagatggttacacggactatgggatg
atcgggtgtacccagccccggcgtgtggctgccatgtcagtggccaagagagtcagtgaa
gagatggggggcaaccttggagaagaggtgggctatgccatccgctttgaggactgcact
tcggaaaacaccttgatcaagtacatgacggatgggatcctgctgcgcgagtccctccgg
gaggctgacctggaccactacagcgccgtcatcatggatgaggcccacgagcgctccctc
aacaccgacgtgctttttgggctgctccgggaggttgtggctcgacgctcagacctgaag
ctcattgtcacgtcagctactatggatgcagaaaagtttgctgccttctttgggaatgta
cccattttccacatccctgggcggacttttcctgttgacatcctcttcagcaagaccccg
caggaagattacgtggaggccgcggtgaagcagtccttgcaggtacacctgtctggggcc
cctggggacatcctgatcttcatgccaggccaagaggacattgaggtgacatctgaccag
atcgtggagcacctggaggagctggagaacgcgcctgcgctggcggtactgcccatctac
tcccagctgccgtctgacctgcaggccaagatcttccagaaggctccagatggtgtccgg
aagtgcatcgtcgctaccaacattgctgagacgtctctgactgttgatggcatcatgttt
gtcatcgactctggctactgcaagttaaaggtcttcaaccccaggattggcatggatgcc
ctgcagatttaccccattagccaggccaatgccaaccagaggtcagggagagctggcagg
acgggcccaggtcagtgtttcaggctctacacgcagagcgcttacaagaacgaactgctg
accaccaccgtgcccgagatccagaggaccaacctagccaatgtggtgctgctgctcaag
tccctgggcgtgcaggacctgctgcagttccacttcatggacccgccccccgaggacaac
atgctcaactccatgtaccagctctggatcctcggagccctggacaacacaggtggtctc
acgtccacagggcggctgatggtggagttcccactggacccggccctctctaagatgctc
atcgtgtcctgtgacatgggctgcagctccgagatcctgctcatcgtctccatgctctcg
gtccccgccatcttctacaggcccaagggcagagaagaggagagcgatcaaatccgggag
aagtttgctgtccccgaaagtgaccacctgacctacctgaatgtctacctgcagtggaag
aacaacaattactccaccatctggtgcaatgaccacttcatccacgccaaggccatgcgg
aaggttcgggaggtacgggcccagcttaaggatattatggtgcagcagcggatgagcctg
gcctcatgtggcaccgactgggacattgtcaggaagtgtatctgtgctgcctatttccac
caggcagccaagctcaaggggattggggaatatgtgaacatccgcacagggatgccctgc
cacttacaccccaccagctccctcttcggcatgggctacacccctgactacattgtgtat
cacgagctggtcatgaccaccaaggagtacatgcagtgtgtgaccgctgtggatggagag
tggctggccgagttaggccccatgttctacagtgtgaagcaggcaggcaaatctcgccag
gagaatcgtcgtcgggctaaagaagaggcctctgccatggaagaggagatggccttggcc
gaggagcagttgcgtgcccggcgacaggagcaggagaagcgcagccccttgggcagtgtc
aggtccacaaagatctacactccaggacggaaagagcagggggagcccatgacgcctcgc
cgcacgccagcccgctttggactgtga

DBGET integrated database retrieval system