KEGG   Mus musculus (mouse): 64378
Entry
64378             CDS       T01002                                 

Gene name
Gpr88, AW061286, St, Strg
Definition
(RefSeq) G-protein coupled receptor 88
  KO
K08422  G protein-coupled receptor 88
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    64378 (Gpr88)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Others
   Orphan GPCRs / unclassified GPCRs
    64378 (Gpr88)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx Caps_synth_CapC Wzy_C
Other DBs
NCBI-GeneID: 64378
NCBI-ProteinID: NP_071872
MGI: 1927653
Ensembl: ENSMUSG00000068696
Vega: OTTMUSG00000054451
UniProt: Q9EPB7 B2RXU4
Position
3; 3 G1
AA seq 384 aa
MTNSSSTSTSTTTGGSLLLLCEEEESWAGRRIPVSLLYSGLAIGGTLANGMVIYLVSSFR
KLQTTSNAFIVNGCAADLSVCALWMPQEAVLGLLPSGSAEPPGDWDGGGGSYRLLRGGLL
GLGLTVSLLSHCLVALNRYLLITRAPATYQVLYQRRHTVGMLALSWALALGLVLLLPPWA
PKPGAEPPQVHYPALLAAGALLAQTALLLHCYLGIVRRVRVSVKRVSVLNFHLLHQLPGC
AAAAAAFPAAPHAPGPGGAAHPAQPQPLPAALQPRRAQRRLSGLSVLLLCCVFLLATQPL
VWVSLASGFSLPVPWGVQAASWLLCCALSALNPLLYTWRNEEFRRSVRSVLPGVGDAAAA
AAAATAVPAMSQAQLGTRAAGQHW
NT seq 1155 nt   +upstreamnt  +downstreamnt
atgaccaactcctcctccacttcgacctccaccactaccgggggatcgctgctgctgctc
tgcgaggaagaagaatcgtgggcgggccggcggatcccggtgtctctcctgtactcgggc
ctggccatcgggggcacgctggccaacggtatggtcatctatctcgtgtcgtccttccga
aagctgcagaccaccagcaacgccttcatcgtgaatggctgcgccgcggatctcagcgtc
tgcgccctctggatgccacaggaggcggtgctggggctcctgccctcgggctccgcggag
cccccgggggactgggacggtggcggaggcagctaccgcctgctccggggcgggttgttg
ggcctcgggctcactgtgtcccttctgtcccattgcctcgtggcgctgaaccgctacctg
ctcatcaccagggcgcctgccacctaccaggtgctctaccaacggcgccacacggtgggc
atgctggcactgtcctgggcgctcgccttgggtctggtgctgctgctcccgccctgggct
cctaagcccggagccgagccaccgcaagtccactaccccgcgctcctggcggcgggagcg
ctgcttgcgcagacggcgctgctgttgcactgctacctgggcatcgtgcgccgcgtgcgc
gtcagcgtcaagcgggtcagcgtgctcaacttccacctgctgcaccagctacccggctgc
gccgccgccgccgccgccttccccgccgccccgcacgcgccgggtccgggaggcgccgcg
catcccgcgcagcctcaacccctgccggccgctctgcagcctcgccgggcgcagcggcgt
ctcagcggcttgtcggtgctgctgctctgctgcgtcttcctgctggccacgcagccgctg
gtgtgggtgagcctggccagtggcttctccctcccggtgccctggggcgtgcaggcggcc
agctggctcctgtgctgcgccctgtcggcgctcaacccgctgctctacacgtggaggaac
gaggagttccgcagatccgtgcgatctgtcctgccgggcgtcggggacgcggctgcggcc
gccgcggccgccaccgcggtgccagccatgtcccaggcgcaactgggtacccgggcggct
ggccagcactggtaa

DBGET integrated database retrieval system