KEGG   Mus musculus (mouse): 64424
Entry
64424             CDS       T01002                                 

Gene name
Polr1e, 53kD, 53kDa, AU042259, D030019D19Rik, Paf, Paf53, Pr, Praf1
Definition
(RefSeq) polymerase (RNA) I polypeptide E
  KO
K03005  DNA-directed RNA polymerase I subunit RPA49
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    64424 (Polr1e)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    64424 (Polr1e)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase I system
   RNA polymerase I
    Pol I specific subunits
     64424 (Polr1e)
SSDB
Motif
Pfam: RNA_pol_I_A49
Other DBs
NCBI-GeneID: 64424
NCBI-ProteinID: NP_001272729
MGI: 1929022
Ensembl: ENSMUSG00000028318
Vega: OTTMUSG00000007388
UniProt: Q8K202 Q3V1B9
Position
4; 4 B1
AA seq 482 aa
MATLESPGMDDQAGDTETEALQSARWLYCGEPDDRQKAVLVQFSNGKLQNPGDMRFTLYN
STDLVNPRQRSHRIVAAETDRLSYVGNNFGTGALKCNALCRHFVGILNKTSGQMEVYDAE
LFNMQPLFAGMGTEVIKLGGQHLYLLAFCQPSKNLAEAGDLLLSRHRQGHCIAVLLDDDA
IEREPPLENQNKTFRDKLDSCIEAFGSTKQKRSLNSRRMNKVGSESLNLSVAKAAESIID
TKGVNALVSDAMQDDLQDGVLYLPPCYADAAKPEDVYRFEDILSPAEYDALESPSEAFRK
VTSEDILKMIEENSHCSYVIEMLKSLPIDEVHRNRQARSIWFLDALIRFRAQKVIKGKRA
LGPGIPHIINTKLLKQFTCLTYNNGRLQNLISSSMRAKITSYAIILALHINNFQVDLTAL
QKDLKLSEKRMIEIAKAMRLKISKQKVSLADGREESHRLGTLSVPLPPAQNSDRQSKRRK
MN
NT seq 1449 nt   +upstreamnt  +downstreamnt
atggctactctggagtctcctgggatggatgaccaggctggagacacggagacagaggcg
ctacagagtgcaaggtggctgtactgtggagagcccgacgacaggcagaaagctgtgctg
gtccagttctccaatgggaagctgcagaatccgggcgacatgcgcttcaccttgtacaac
agcaccgacttagtaaaccccaggcagaggagtcaccggatcgtggcagctgaaacagat
aggctctcctatgtcggaaacaattttgggaccggtgccctcaaatgcaatgctctttgc
agacactttgtgggaattctgaataagacctctggccagatggaagtctatgatgccgaa
ctgttcaacatgcagccgctgtttgctggaatgggaactgaagtcatcaaacttggtggc
caacacctttacctgctggccttctgccaaccctccaagaacctggctgaggcaggtgac
ctgctgctgagccgacaccggcaaggccattgcattgcagtcctgctggatgacgatgct
attgagcgagagcctcctctggagaatcagaacaagactttcagggacaagttggattct
tgcattgaagcctttggaagcaccaagcagaagcggtccctaaactccaggcggatgaac
aaagttggcagcgagtctctgaatctcagtgtggcgaaagccgcggagagtattattgat
acaaagggtgtgaatgcgctggtcagcgatgccatgcaggatgacttacaagatggcgtc
ctctaccttcctccctgctacgctgacgcagccaagccggaagacgtgtatagatttgaa
gacattctgtccccggccgagtatgatgctcttgagagcccatccgaagccttcagaaag
gtcacatcggaagacatactgaagatgattgaagagaacagccactgctcctacgtcata
gaaatgctgaagtctctgcccatagatgaggtccaccggaaccggcaagcccggagcatc
tggttcctagacgccctcatcagattccgagctcagaaagtgataaaggggaaaagagcc
ttagggcctggaatcccgcacattatcaacaccaagctgctgaaacagttcacctgcttg
acctacaacaacggcaggttacagaacctcatttcaagttctatgagggccaagatcact
tcgtatgcgattatacttgccctgcacataaataacttccaggttgacctgacagcgttg
cagaaggacttgaagctgagtgagaaaaggatgattgagatagcgaaagccatgaggctg
aagatctccaaacaaaaggtgtccctggcagatggcagggaagagagtcacagactgggc
actctgtctgtcccactgcctccagcccagaactctgatcgacagtcaaagcggaggaaa
atgaactag

DBGET integrated database retrieval system