KEGG   Mus musculus (mouse): 64436
Entry
64436             CDS       T01002                                 

Gene name
Inpp5e, 1200002L24Rik, 72kDa, mKIAA0123
Definition
(RefSeq) inositol polyphosphate-5-phosphatase E
  KO
K20278  inositol polyphosphate 5-phosphatase INPP5E [EC:3.1.3.36]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00562  Inositol phosphate metabolism
mmu01100  Metabolic pathways
mmu04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    64436 (Inpp5e)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    64436 (Inpp5e)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.36  phosphoinositide 5-phosphatase
     64436 (Inpp5e)
SSDB
Motif
Pfam: Exo_endo_phos
Other DBs
NCBI-GeneID: 64436
NCBI-ProteinID: NP_149125
MGI: 1927753
Ensembl: ENSMUSG00000026925
Vega: OTTMUSG00000012777
UniProt: Q9JII1
Position
2; 2 A3
AA seq 647 aa
MPSKSACLRHTEAPGQLEGRMLQGQPPNTEKKLIPTPGFLPASDSQGSETNPMPPFSIPA
KTSNQNPQTKANLITPQPPIRPKLERTLSLDDKGWRRRRFRGSQEDLTVQNGASPCRGSL
QDSVAQSPAYSRPLPCLSTSLQEIPKSRRATGSEGGSPSLWSDCLSGMISTSLDLLHRDA
ASGGPPSRLASLHASHTPPAMDLSIASSSLRTANKVDPEHTDYKLRMQTRLVRAHSNLGP
SRPRSPLAGDDHSIHSARSFSLLAPIRTKDIRSRSYLEGSLLASGALLGAEELARYFPDR
NMALFVATWNMQGQKELPASLDEFLLPTEADYTQDLYVIGIQEGCSDRREWETRLQETLG
PQYVLLSSAAHGVLYMSLFIRRDLIWFCSEVEYSTVTTRIVSQIKTKGALGVSFTFFGTS
FLFITSHFTSGDGKVAERLLDYSRTIQALALPRNVPDTNPYRSSAGDVTTRFDEVFWFGD
FNFRLSGGRVAVEAFLKQKPEVDVLALLQHDQLTREMKKGSIFRGFEEAEIHFLPSYKFD
IGKDTYDSTSKQRTPSYTDRVLYKSRHKGDICPMKYSSCPGIKTSDHRPVYGLFQVKVRP
GRDNIPLAAGKFDRELYLIGIKRRISKEIQRQEALKSQSSSAVCTVS
NT seq 1944 nt   +upstreamnt  +downstreamnt
atgccatccaagtcagcttgcctgcgtcacactgaggcacctgggcagctagaaggcaga
atgctccagggacagcctccgaacacggaaaagaagctcatcccaacaccaggcttctta
ccagcctctgactctcagggttcagagacaaaccccatgcctcctttcagcattccagca
aaaacaagcaaccagaacccacaaactaaggcaaatctcatcaccccacagccacccatt
agacccaagttggagcgaaccctgtccctcgatgacaagggctggagaaggaggcgtttc
cggggtagtcaggaggatctgactgtccagaatggggccagtccctgcaggggctccttg
caagactcagtagcccagtcccctgcctacagccgtcccctgccctgcctcagcacatcc
ttgcaggagatacctaagtcccgaagggccacaggcagtgagggagggagcccatccttg
tggagtgactgtctttctggaatgatcagcacctccttggacctcctgcacagagatgct
gcctcaggtgggcccccctccaggttggcaagtttgcatgcctcacacacaccaccagct
atggacctcagcatagcctccagctccctgagaacagcaaacaaggttgaccccgagcac
acggactacaagctccgcatgcagaccagactggtcagggcccacagcaacctgggccct
agcagaccccggagccccttggctggtgacgatcactccattcactcagccagatctttc
agccttctggcccccatccgcaccaaggacatcagaagcaggagctatctggagggaagt
cttctggccagtggggccctgctaggagcagaagagctggccaggtacttcccagaccga
aacatggctctcttcgtggctacctggaacatgcagggccagaaggagctcccagcgagc
ctggatgagtttctgctccccaccgaggctgactacactcaggacctgtatgtcattgga
attcaggagggctgctctgacaggcgggagtgggagacacgcctgcaggagacactgggc
cctcagtatgtactgctgtcatcagcagcacatggggtcctgtacatgtccctgtttatc
cgtagggacctcatctggttctgctcagaggtcgagtactccacagtaactacacgcatc
gtgtctcagatcaagaccaagggggccctgggcgtcagcttcaccttttttggcacctcc
ttcctcttcatcacatctcacttcacctctggagatgggaaggtagcagagcggctactg
gactacagcagaaccatccaagccctagccctgccccggaatgtgccagacacaaatccc
taccgctctagtgcaggggatgtcactacccggtttgatgaggtcttctggtttggggac
ttcaacttccgcctgagtggtggacgagtggctgtggaggccttcctgaagcagaaacct
gaggtggatgtgctggctctcctccaacacgaccagctcacccgggagatgaagaaaggg
tccatcttcaggggctttgaggaggcagagattcactttcttccatcctacaagtttgac
attgggaaggacacctacgacagcacctccaagcaaaggacaccctcctacacagaccga
gtcctatacaaaagccgtcacaagggtgacatctgtcccatgaagtattcctcttgtcct
gggatcaagacttcagaccaccgtcctgtgtatggcttgttccaggtgaaagtgaggcca
ggacgagacaacatcccattagctgccggcaagtttgaccgagaattgtacttgatagga
attaaaaggcggatttcaaaggagattcagagacaggaagcactgaagagccagagctcc
agtgcagtttgcaccgtgtcctga

DBGET integrated database retrieval system