KEGG   Mus musculus (mouse): 64450
Entry
64450             CDS       T01002                                 

Symbol
Gpr85, 2900026B03Rik
Name
(RefSeq) G protein-coupled receptor 85
  KO
K04302  super conserved receptor expressed in brain 2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    64450 (Gpr85)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Others
   Super conserved receptor expressed in brain (SREB)
    64450 (Gpr85)
SSDB
Motif
Pfam: 7tm_1 7tm_4
Other DBs
NCBI-GeneID: 64450
NCBI-ProteinID: NP_001317595
MGI: 1927851
Ensembl: ENSMUSG00000048216
Vega: OTTMUSG00000022773
UniProt: P60894 Q6ZWR2
Position
6:complement(13834405..13839951)
AA seq 370 aa
MANYSHAADNILQNLSPLTAFLKLTSLGFIIGVSVVGNLLISILLVKDKTLHRAPYYFLL
DLCCSDILRSAICFPFVFNSVKNGSTWTYGTLTCKVIAFLGVLSCFHTAFMLFCISVTRY
LAIAHHRFYTKRLTFWTCLAVICMVWTLSVAMAFPPVLDVGTYSFIREEDQCTFQHRSFR
ANDSLGFMLLLALILLATQLVYLKLIFFVHDRRKMKPVQFVAAVSQNWTFHGPGASGQAA
ANWLAGFGRGPTPPTLLGIRQNANTTGRRRLLVLDEFKMEKRISRMFYIMTFLFLTLWGP
YLVACYWRVFARGPVVPGGFLTAAVWMSFAQAGINPFVCIFSNRELRRCFSTTLLYCRKS
RLPREPYCVI
NT seq 1113 nt   +upstreamnt  +downstreamnt
atggcgaactatagccatgcagccgacaacattttgcaaaatctctcgcctctaacagcc
tttctgaaactgacttccctgggtttcataataggagtcagcgttgtgggcaaccttctg
atctccattttgctagtgaaagataagaccttgcatagagctccttactacttcctgctg
gatctgtgctgctcagacatcctcagatctgcaatttgttttccatttgtattcaactct
gtcaaaaatggctccacctggacttacgggactctgacttgcaaagtgattgccttcctg
ggggttttgtcctgtttccacactgccttcatgctcttctgcatcagcgtcaccagatac
ttagccatcgcccatcaccgcttctatacaaagaggctgaccttttggacgtgtttggct
gtgatctgcatggtgtggactctgtccgtggccatggcattccccccagttttagatgta
ggcacctactccttcattagggaggaggatcaatgcaccttccaacaccgctccttcagg
gctaacgattccctaggatttatgctgctccttgctctcatcctcctagccacacagctt
gtctacctcaagctgatattttttgtccacgatcgaaggaaaatgaagccagtccagttt
gtagcagcagtgagtcagaactggacctttcatggccctggagctagcggccaggcagct
gccaattggctagcaggatttggaaggggtcccacaccacccaccttgctgggcatcagg
caaaatgcgaataccacaggcagaaggcggctattggtcttggatgagttcaaaatggag
aaaagaatcagcagaatgttttatataatgactttcctcttcctaaccttgtggggtccc
tacctggtggcctgctattggagagtttttgcacgagggcctgtagtaccagggggattt
ctaacagccgctgtctggatgagtttcgcccaagcaggaatcaatccctttgtctgcatt
ttctccaacagggagctgaggcgctgtttcagcacaacccttctttactgcagaaaatcc
aggttaccaagggaaccttactgtgttatatga

DBGET integrated database retrieval system