KEGG   Mus musculus (mouse): 64654
Entry
64654             CDS       T01002                                 

Gene name
Fgf23
Definition
(RefSeq) fibroblast growth factor 23
  KO
K22428  fibroblast growth factor 23
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu05200  Pathways in cancer
mmu05218  Melanoma
mmu05224  Breast cancer
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    64654 (Fgf23)
   04014 Ras signaling pathway
    64654 (Fgf23)
   04015 Rap1 signaling pathway
    64654 (Fgf23)
   04020 Calcium signaling pathway
    64654 (Fgf23)
   04151 PI3K-Akt signaling pathway
    64654 (Fgf23)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    64654 (Fgf23)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    64654 (Fgf23)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    64654 (Fgf23)
  09162 Cancer: specific types
   05226 Gastric cancer
    64654 (Fgf23)
   05218 Melanoma
    64654 (Fgf23)
   05224 Breast cancer
    64654 (Fgf23)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    64654 (Fgf23)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    64654 (Fgf23)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   64654 (Fgf23)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   64654 (Fgf23)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 64654
NCBI-ProteinID: NP_073148
MGI: 1891427
Ensembl: ENSMUSG00000000182
Vega: OTTMUSG00000056344
UniProt: Q9EPC2 Q3U1V5
Position
6; 6 F3
AA seq 251 aa
MLGTCLRLLVGVLCTVCSLGTARAYPDTSPLLGSNWGSLTHLYTATARTSYHLQIHRDGH
VDGTPHQTIYSALMITSEDAGSVVITGAMTRRFLCMDLHGNIFGSLHFSPENCKFRQWTL
ENGYDVYLSQKHHYLVSLGRAKRIFQPGTNPPPFSQFLARRNEVPLLHFYTVRPRRHTRS
AEDPPERDPLNVLKPRPRATPVPVSCSRELPSAEEGGPAASDPLGVLRRGRGDARGGAGG
ADRCRPFPRFV
NT seq 756 nt   +upstreamnt  +downstreamnt
atgctagggacctgccttagactcctggtgggcgtgctctgcactgtctgcagcttgggc
actgctagagcctatccggacacttccccattgcttggctccaactggggaagcctgacc
cacctgtacacggctacagccaggaccagctatcacctacagatccatagggatggtcat
gtagatggcaccccccatcagaccatctacagtgccctgatgattacatcagaggacgcc
ggctctgtggtgataacaggagccatgactcgaaggttcctttgtatggatctccacggc
aacatttttggatcgcttcacttcagcccagagaattgcaagttccgccagtggacgctg
gagaatggctatgacgtctacttgtcgcagaagcatcactacctggtgagcctgggccgc
gccaagcgcatcttccagccgggcaccaacccgccgcccttctcccagttcctggctcgc
aggaacgaggtcccgctgctgcatttctacactgttcgcccacggcgccacacgcgcagc
gccgaggacccaccggagcgcgacccactgaacgtgctcaagccgcggccccgcgccacg
cctgtgcctgtatcctgctctcgcgagctgccgagcgcagaggaaggtggccccgcagcc
agcgatcctctgggggtgctgcgcagaggccgtggagatgctcgcgggggcgcgggaggc
gcggataggtgtcgcccctttcccaggttcgtctag

DBGET integrated database retrieval system