KEGG   Mus musculus (mouse): 64659
Entry
64659             CDS       T01002                                 

Gene name
Mrps14, 1810032L21Rik, AL022847, Rpms14
Definition
(RefSeq) mitochondrial ribosomal protein S14
  KO
K02954  small subunit ribosomal protein S14
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    64659 (Mrps14)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mmu03011]
    64659 (Mrps14)
Ribosome [BR:mmu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    64659 (Mrps14)
  Bacteria
    64659 (Mrps14)
  Archaea
    64659 (Mrps14)
SSDB
Motif
Pfam: Ribosomal_S14
Other DBs
NCBI-GeneID: 64659
NCBI-ProteinID: NP_079750
MGI: 1928141
Ensembl: ENSMUSG00000058267
Vega: OTTMUSG00000021950
UniProt: Q9CR88
Position
1; 1 H2.1
AA seq 128 aa
MAASVLGSLLRTFRQAVPPSASGQVRGYYVDWRMLRDLKRRKMAYEYADERLRINSLRKN
TILPKDLQEMAGDEIAALPRDSCPVRIRNRCVMTSRPRGVKRRWRLSRIVFRHLADHGLL
SGVQRAIW
NT seq 387 nt   +upstreamnt  +downstreamnt
atggcggcgtccgtgctaggctcgctgctgcggaccttccggcaggcagttcctccatca
gcgtcaggtcaagttcgaggttactatgtagactggagaatgttgcgtgatttgaagaga
cggaaaatggcttatgaatatgcagatgagaggcttcggatcaattcgctcagaaagaat
accattttgccaaaggaccttcaggaaatggctggtgatgaaattgctgcccttccacgg
gatagctgtcctgttagaatcagaaatcgctgtgttatgacatctcgcccacgtggtgtt
aagcgtcgctggagacttagtcgcattgtcttccgccacttagctgaccacgggctactt
tctggagtccagcgagcgatatggtaa

DBGET integrated database retrieval system