KEGG   Mus musculus (house mouse): 64818
Entry
64818             CDS       T01002                                 
Symbol
Krt81, AA589625, Krt2-19
Name
(RefSeq) keratin 81
  KO
K07605  type II keratin, basic
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    64818 (Krt81)
   04147 Exosome [BR:mmu04147]
    64818 (Krt81)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     64818 (Krt81)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   64818 (Krt81)
  Exosomal proteins of other body fluids (saliva and urine)
   64818 (Krt81)
  Exosomal proteins of colorectal cancer cells
   64818 (Krt81)
  Exosomal proteins of bladder cancer cells
   64818 (Krt81)
SSDB
Motif
Pfam: Filament Keratin_2_head TPR_MLP1_2 Nuf2_DHR10-like CALCOCO1 CATRA-C DUF6074 Glutaredoxin2_C Golgin_A5 DASH_Duo1
Other DBs
NCBI-GeneID: 64818
NCBI-ProteinID: NP_001159629
MGI: 1928858
Ensembl: ENSMUSG00000067615
UniProt: Q9ERE2
Position
15:complement(101356942..101361646)
AA seq 481 aa
MTCGSGFCGRAFSCASACGPRPGRCCISAAPYRGISCYRGLSGGFGSQSVCGAFRSGSCG
RSFGYRSGGICGPSPPCITTVSVNESLLTPLNLEIDPNAQCVKHEEKEQIKCLNSKFAAF
IDKVRFLEQQNKLLETKWQFYQNRKCCESNMEPLFEGYIEALRREAECVEADSGRLAAEL
NHAQESMEGYKKRYEEEVSLRATAENEFVALKKDVDCAYLRKSDLEANAEALTQETDFLR
RMYDEETRILHSHISDTSIVVKMDNSRDLNMDCVVAEIKAQYDDIASRSRAEAESWYRTK
CEEIKATVIRHGETLRRTREEINELNRMIQRLTAEIENAKCQNTKLEAAVTQSEQQGEAA
LADARCKLAELEGALQKAKQDMACLLKEYQEVMNSKLGLDVEITTYRRLLEGEEQRLCEG
VGAVNVCVSSSRGGVVCGDLCVSGSRPVIGSACSAPCSGNLAVNTGLCAPCGSAVSCGRK
C
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgacctgtggatcaggattctgtggccgcgccttcagctgcgcctcagcctgcggaccc
aggcccggccgctgctgcatctctgcagctccctacaggggcatctcctgctaccgcgga
ctctcagggggcttcggcagccagagtgtctgtggggccttccgctctggctcctgtgga
cgcagcttcgggtaccgctctggaggcatctgcgggcccagcccaccctgcatcaccacc
gtttctgtcaatgagagcctgctcacgcccctgaacctggagatcgaccccaatgctcag
tgtgtgaagcatgaggagaaggagcagatcaagtgtctcaacagcaagttcgcagccttc
atcgacaaggtgcgcttcctggagcagcagaacaagctgctggagaccaagtggcagttc
taccagaaccgcaagtgctgtgagagcaacatggagcctctgttcgagggctacatcgag
gcgctgaggcgggaagctgagtgtgtggaggccgacagcgggaggctggctgctgagctc
aaccatgcacaggagtccatggagggctacaagaagagatacgaggaggaagtttctctg
agagccacggccgagaatgagtttgtggctctgaagaaggatgtggactgtgcctacctg
cgcaagtcagatctggaggccaacgcagaggcactgacccaggagaccgacttcctgagg
agaatgtatgacgaggagacccgcatcctccattcccacatctcagacacctccatcgtc
gtcaagatggacaacagccgggacctgaacatggactgtgtcgtggctgagatcaaggct
cagtatgatgacattgccagccgcagccgtgctgaggctgagtcctggtaccgcaccaag
tgtgaggagataaaggccacagtgatccggcatggagagactctgcgccgcaccagagag
gagatcaatgagctgaacagaatgatccagaggctgactgctgagatcgagaatgccaag
tgccagaacaccaagctggaggctgctgtgacccagtctgagcagcagggagaggctgcc
cttgctgatgcccgctgcaagctggctgagctggagggtgccctgcagaaggccaagcag
gacatggcctgcctgctcaaggagtaccaggaggtgatgaactccaagctggggctggac
gttgagatcaccacctacaggcgcctgctggagggcgaggaacagagactgtgtgaaggt
gtaggagctgtgaatgtctgtgtcagcagctcccgaggaggagtcgtatgtggggacctg
tgtgtgtcaggttccaggccagtgatcggcagtgcctgcagcgccccctgcagcgggaac
ttggcggtgaacacaggcctgtgcgcaccctgtggttcagctgtgtcctgtggccgtaaa
tgttaa

DBGET integrated database retrieval system